TARA_SAMEA6034818_MAG_00000020 - 38 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

TARA_SAMEA6034818_MAG_00000020-scaffold_1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	transAT-PKS-like,NRPS	204,575	285,524

TARA_SAMEA6034818_MAG_00000020-scaffold_2

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	NRPS,T1PKS	68,036	176,876

TARA_SAMEA6034818_MAG_00000020-scaffold_3

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	NRPS,transAT-PKS-like	24,373	158,046

TARA_SAMEA6034818_MAG_00000020-scaffold_4

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	NRPS	16,071	110,950

TARA_SAMEA6034818_MAG_00000020-scaffold_6

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	transAT-PKS-like,NRPS	17,783	100,750
Region 6.2	PKS-like	107,864	149,153

TARA_SAMEA6034818_MAG_00000020-scaffold_8

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	hglE-KS,T1PKS	39,491	93,252

TARA_SAMEA6034818_MAG_00000020-scaffold_9

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	lanthipeptide-class-iv	140,233	162,617

TARA_SAMEA6034818_MAG_00000020-scaffold_10

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	lanthipeptide-class-ii	20,428	43,670
Region 10.2	NRPS	135,008	181,733

TARA_SAMEA6034818_MAG_00000020-scaffold_11

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	NRPS,RiPP-like	8,295	85,705

TARA_SAMEA6034818_MAG_00000020-scaffold_12

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	lanthipeptide-class-ii	20,893	44,117

TARA_SAMEA6034818_MAG_00000020-scaffold_13

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	RiPP-like	70,117	82,039
Region 13.2	NRPS	131,117	192,067

TARA_SAMEA6034818_MAG_00000020-scaffold_14

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	NRPS,T1PKS,lanthipeptide-class-iv	12	183,056

TARA_SAMEA6034818_MAG_00000020-scaffold_17

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	betalactone	37,867	66,615

TARA_SAMEA6034818_MAG_00000020-scaffold_18

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	ladderane,NRPS,transAT-PKS-like	99,022	157,610

TARA_SAMEA6034818_MAG_00000020-scaffold_20

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	T3PKS,NRPS,T1PKS	1	80,316

TARA_SAMEA6034818_MAG_00000020-scaffold_23

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	NRPS,transAT-PKS-like	1	74,443

TARA_SAMEA6034818_MAG_00000020-scaffold_25

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	NRPS	52,608	104,007

TARA_SAMEA6034818_MAG_00000020-scaffold_29

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	lanthipeptide-class-iv	5,794	28,442
Region 29.2	lanthipeptide-class-i	62,516	88,427

TARA_SAMEA6034818_MAG_00000020-scaffold_32

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	NRPS	1	41,807

TARA_SAMEA6034818_MAG_00000020-scaffold_34

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	RRE-containing	4,365	24,649

TARA_SAMEA6034818_MAG_00000020-scaffold_35

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	NRPS	1	24,606

TARA_SAMEA6034818_MAG_00000020-scaffold_36

Region	Type	From	To	Most similar known cluster		Similarity
Region 36.1	lanthipeptide-class-v	1	49,859

TARA_SAMEA6034818_MAG_00000020-scaffold_38

Region	Type	From	To	Most similar known cluster		Similarity
Region 38.1	transAT-PKS-like	6,389	72,139

TARA_SAMEA6034818_MAG_00000020-scaffold_39

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	RiPP-like	26,043	36,930

TARA_SAMEA6034818_MAG_00000020-scaffold_40

Region	Type	From	To	Most similar known cluster		Similarity
Region 40.1	NRPS,T1PKS	1	66,417

TARA_SAMEA6034818_MAG_00000020-scaffold_41

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	NRPS	8,290	64,270

TARA_SAMEA6034818_MAG_00000020-scaffold_42

Region	Type	From	To	Most similar known cluster		Similarity
Region 42.1	LAP	7,055	30,707

TARA_SAMEA6034818_MAG_00000020-scaffold_45

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	NRPS	1	39,100

TARA_SAMEA6034818_MAG_00000020-scaffold_46

Region	Type	From	To	Most similar known cluster		Similarity
Region 46.1	T1PKS,NRPS,NRPS-like,betalactone	1	43,738

TARA_SAMEA6034818_MAG_00000020-scaffold_60

Region	Type	From	To	Most similar known cluster		Similarity
Region 60.1	T1PKS,NRPS	1	38,841

TARA_SAMEA6034818_MAG_00000020-scaffold_61

Region	Type	From	To	Most similar known cluster		Similarity
Region 61.1	NRPS	1	24,783

TARA_SAMEA6034818_MAG_00000020-scaffold_62

Region	Type	From	To	Most similar known cluster		Similarity
Region 62.1	T1PKS	14,999	42,391

TARA_SAMEA6034818_MAG_00000020-scaffold_69

Region	Type	From	To	Most similar known cluster		Similarity
Region 69.1	NRPS	1	25,696

TARA_SAMEA6034818_MAG_00000020-scaffold_71

Region	Type	From	To	Most similar known cluster		Similarity
Region 71.1	thiopeptide	1	23,843

Region	Type	From	To	Similarity
Region 1.1	transAT-PKS-like,NRPS	204,575	285,524
Region 2.1	NRPS,T1PKS	68,036	176,876
Region 3.1	NRPS,transAT-PKS-like	24,373	158,046
Region 4.1	NRPS	16,071	110,950
Region 6.1	transAT-PKS-like,NRPS	17,783	100,750
Region 6.2	PKS-like	107,864	149,153
Region 8.1	hglE-KS,T1PKS	39,491	93,252
Region 9.1	lanthipeptide-class-iv	140,233	162,617
Region 10.1	lanthipeptide-class-ii	20,428	43,670
Region 10.2	NRPS	135,008	181,733
Region 11.1	NRPS,RiPP-like	8,295	85,705
Region 12.1	lanthipeptide-class-ii	20,893	44,117
Region 13.1	RiPP-like	70,117	82,039
Region 13.2	NRPS	131,117	192,067
Region 14.1	NRPS,T1PKS,lanthipeptide-class-iv	12	183,056
Region 17.1	betalactone	37,867	66,615
Region 18.1	ladderane,NRPS,transAT-PKS-like	99,022	157,610
Region 20.1	T3PKS,NRPS,T1PKS	1	80,316
Region 23.1	NRPS,transAT-PKS-like	1	74,443
Region 25.1	NRPS	52,608	104,007
Region 29.1	lanthipeptide-class-iv	5,794	28,442
Region 29.2	lanthipeptide-class-i	62,516	88,427
Region 32.1	NRPS	1	41,807
Region 34.1	RRE-containing	4,365	24,649
Region 35.1	NRPS	1	24,606
Region 36.1	lanthipeptide-class-v	1	49,859
Region 38.1	transAT-PKS-like	6,389	72,139
Region 39.1	RiPP-like	26,043	36,930
Region 40.1	NRPS,T1PKS	1	66,417
Region 41.1	NRPS	8,290	64,270
Region 42.1	LAP	7,055	30,707
Region 45.1	NRPS	1	39,100
Region 46.1	T1PKS,NRPS,NRPS-like,betalactone	1	43,738
Region 60.1	T1PKS,NRPS	1	38,841
Region 61.1	NRPS	1	24,783
Region 62.1	T1PKS	14,999	42,391
Region 69.1	NRPS	1	25,696
Region 71.1	thiopeptide	1	23,843

No secondary metabolite regions were found in these records:: TARA_SAMEA6034818_MAG_00000020-scaffold_5; TARA_SAMEA6034818_MAG_00000020-scaffold_7; TARA_SAMEA6034818_MAG_00000020-scaffold_15; TARA_SAMEA6034818_MAG_00000020-scaffold_16; TARA_SAMEA6034818_MAG_00000020-scaffold_19; TARA_SAMEA6034818_MAG_00000020-scaffold_21; TARA_SAMEA6034818_MAG_00000020-scaffold_22; TARA_SAMEA6034818_MAG_00000020-scaffold_24; TARA_SAMEA6034818_MAG_00000020-scaffold_26; TARA_SAMEA6034818_MAG_00000020-scaffold_27; TARA_SAMEA6034818_MAG_00000020-scaffold_28; TARA_SAMEA6034818_MAG_00000020-scaffold_30; TARA_SAMEA6034818_MAG_00000020-scaffold_31; TARA_SAMEA6034818_MAG_00000020-scaffold_33; TARA_SAMEA6034818_MAG_00000020-scaffold_37; TARA_SAMEA6034818_MAG_00000020-scaffold_43; TARA_SAMEA6034818_MAG_00000020-scaffold_44; TARA_SAMEA6034818_MAG_00000020-scaffold_47; TARA_SAMEA6034818_MAG_00000020-scaffold_48; TARA_SAMEA6034818_MAG_00000020-scaffold_49; TARA_SAMEA6034818_MAG_00000020-scaffold_50; TARA_SAMEA6034818_MAG_00000020-scaffold_51; TARA_SAMEA6034818_MAG_00000020-scaffold_52; TARA_SAMEA6034818_MAG_00000020-scaffold_53; TARA_SAMEA6034818_MAG_00000020-scaffold_54; TARA_SAMEA6034818_MAG_00000020-scaffold_55; TARA_SAMEA6034818_MAG_00000020-scaffold_56; TARA_SAMEA6034818_MAG_00000020-scaffold_57; TARA_SAMEA6034818_MAG_00000020-scaffold_58; TARA_SAMEA6034818_MAG_00000020-scaffold_59; TARA_SAMEA6034818_MAG_00000020-scaffold_63; TARA_SAMEA6034818_MAG_00000020-scaffold_64; TARA_SAMEA6034818_MAG_00000020-scaffold_65; TARA_SAMEA6034818_MAG_00000020-scaffold_66; TARA_SAMEA6034818_MAG_00000020-scaffold_67; TARA_SAMEA6034818_MAG_00000020-scaffold_68; TARA_SAMEA6034818_MAG_00000020-scaffold_70; TARA_SAMEA6034818_MAG_00000020-scaffold_72; TARA_SAMEA6034818_MAG_00000020-scaffold_73; TARA_SAMEA6034818_MAG_00000020-scaffold_74; TARA_SAMEA6034818_MAG_00000020-scaffold_75; TARA_SAMEA6034818_MAG_00000020-scaffold_76; TARA_SAMEA6034818_MAG_00000020-scaffold_77; TARA_SAMEA6034818_MAG_00000020-scaffold_78; TARA_SAMEA6034818_MAG_00000020-scaffold_79; TARA_SAMEA6034818_MAG_00000020-scaffold_80; TARA_SAMEA6034818_MAG_00000020-scaffold_81; TARA_SAMEA6034818_MAG_00000020-scaffold_82; TARA_SAMEA6034818_MAG_00000020-scaffold_83; TARA_SAMEA6034818_MAG_00000020-scaffold_84

Compact view

TARA_SAMEA6034818_MAG_00000020-scaffold_1 - Region 1 - NRPS,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 204,575 - 285,524 nt. (total: 80,950 nt) Show pHMM detection rules used

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 204574 - 285524:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal - mal - mal - leu - ala - val - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_1_172

Search NORINE for peptide: strict or relaxed

AMP-binding (8485..8878): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (9548..9954): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (10621..11019): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (11711..12115): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWgGfTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (12779..13182): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_2 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 68,036 - 176,876 nt. (total: 108,841 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 68035 - 176876:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal - NMe-gly - gly - X - gln - pro - X - leu) + (X - X - X - X - X - NMe-val - X) + (ser - ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_2_76

Search NORINE for peptide: strict or relaxed

AMP-binding (572..992): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeVtAddK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_2_77

Search NORINE for peptide: strict or relaxed

AMP-binding (546..961): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

PKS_AT (1683..1974): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; 2-Methylbutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.4
Methoxymalonyl-CoA: 88.3
inactive: 85.6
Methylmalonyl-CoA: 77.2
Ethylmalonyl-CoA: 56.3
Propionyl-CoA: 48.6
2-Methylbutyryl-CoA: 35.3
trans-1,2-CPDA: 34.5
CHC-CoA: 26.6
Isobutyryl-CoA: 19.6
fatty_acid: 18.8
Benzoyl-CoA: 17.7
Acetyl-CoA: 16.1
3-Methylbutyryl-CoA: 10.5

TARA_SAMEA6034818_MAG_00000020-scaffold_2_78

Search NORINE for peptide: strict or relaxed

AMP-binding (536..935): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHtGdvlK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 60% (weak)

AMP-binding (1585..1981): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DarHFSfliK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

AMP-binding (2639..3025): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWvcAAVwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

AMP-binding (3679..4078): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: dPRNfVlqaK
Nearest Stachelhaus code:: aad
Stachelhaus code match:: 50% (weak)

AMP-binding (4739..5125): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWlVgAVwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

AMP-binding (5784..6181): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (7252..7636): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWvIAAVwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_2_79

Search NORINE for peptide: strict or relaxed

CAL_domain (49..483): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 22.1
NH2: 18.4
AHBA: 17.8
Acetyl-CoA: 5.3
shikimic_acid: 0.0

A-OX (1167..1934): X

PKS_AT (2635..2930): mal

ATSignature: 2-Rhyd-Malonyl-CoA, Malonyl-CoA

Top 3 matches:: 2-Rhyd-Malonyl-CoA: 54.2%; Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 109.4
inactive: 62.1
Methoxymalonyl-CoA: 57.9
Methylmalonyl-CoA: 47.0
Isobutyryl-CoA: 32.3
Ethylmalonyl-CoA: 31.5
Benzoyl-CoA: 26.4
2-Methylbutyryl-CoA: 20.8
Propionyl-CoA: 19.9
CHC-CoA: 19.0
trans-1,2-CPDA: 15.7
Acetyl-CoA: 15.0
3-Methylbutyryl-CoA: 13.8
fatty_acid: 0.0

AMP-binding (3576..3984): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (5048..5450): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGvVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (6109..6518): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWHFGfINK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 80% (moderate)

AMP-binding (7182..7583): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLvqK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

AMP-binding (8242..8639): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHLAK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (9294..9706): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfvfraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

AMP-binding (10365..10768): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DIFhWGcimK
Nearest Stachelhaus code:: phg
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_3 - Region 1 - NRPS,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 24,373 - 158,046 nt. (total: 133,674 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 24372 - 158046:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ccmal - ccmal - ccmal - ohmal - mal - ccmal - ohmal) + (mal - mal - mal) + (gly - mal) + (thr - ala - thr - leu - X - ala - glu - ala - glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_3_33

Search NORINE for peptide: strict or relaxed

AMP-binding (495..900): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1576..1967): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2647..3050): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: awWNIcMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 70% (weak)

AMP-binding (3726..4113): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (4791..5204): X

NRPSPredictor2: glu, gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAenMGAisK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (5865..6258): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (6939..7349): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 90% (moderate)

AMP-binding (8043..8441): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (9119..9526): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGlVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_3_34

Search NORINE for peptide: strict or relaxed

AMP-binding (499..890): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2368..2669): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTiaK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_4 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 16,071 - 110,950 nt. (total: 94,880 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 16070 - 110950:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ala - ser - X - gly) + (asp - D-cys - X - cys) + (asn - gly - cys - Me-cys) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_4_24

Search NORINE for peptide: strict or relaxed

AMP-binding (677..1103): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeVtAddK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_4_25

Search NORINE for peptide: strict or relaxed

AMP-binding (540..949): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DATKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1633..2029): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQiGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (2709..3103): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

AMP-binding (4018..4417): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSmIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_4_26

Search NORINE for peptide: strict or relaxed

AMP-binding (446..843): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKfGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

AMP-binding (1549..1958): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (3085..3493): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VgWkIStAeK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 60% (weak)

AMP-binding (4158..4564): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_4_28

Search NORINE for peptide: strict or relaxed

CAL_domain (13..458): pk

minowa: NH2

Prediction, score:

NH2: 162.1
fatty_acid: 23.3
shikimic_acid: 16.0
AHBA: 12.8
Acetyl-CoA: -2.8

AMP-binding (1140..1545): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2199..2612): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DiFNNALTfK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 80% (moderate)

AMP-binding (3285..3693): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSmvEK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

AMP-binding (4368..4782): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHvGcqiK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (5441..5836): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQwGMvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_6 - Region 1 - NRPS,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 17,783 - 100,750 nt. (total: 82,968 nt) Show pHMM detection rules used

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 17782 - 100750:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - mal - Me-ccmal) + (ccmal - ohmal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_6_32

Search NORINE for peptide: strict or relaxed

AMP-binding (5631..5935): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_6 - Region 2 - PKS-like

Download region GenBank file

Download region SVG

Location: 107,864 - 149,153 nt. (total: 41,290 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6034818_MAG_00000020-scaffold_8 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 39,491 - 93,252 nt. (total: 53,762 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 39490 - 93252:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_8_42

PKS_AT (576..878): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 76.9
Methoxymalonyl-CoA: 36.2
Methylmalonyl-CoA: 30.2
inactive: 21.6
CHC-CoA: 12.1
fatty_acid: 11.2
Isobutyryl-CoA: 11.0
trans-1,2-CPDA: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TARA_SAMEA6034818_MAG_00000020-scaffold_8_43

PKS_AT (1026..1325): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 26.4
Methylmalonyl-CoA: 22.5
Ethylmalonyl-CoA: 2.2
Malonyl-CoA: 1.0
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TARA_SAMEA6034818_MAG_00000020-scaffold_9 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 140,233 - 162,617 nt. (total: 22,385 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6034818_MAG_00000020-scaffold_10 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 20,428 - 43,670 nt. (total: 23,243 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000020-scaffold_10_18 - Putative Class II

TARA_SAMEA6034818_MAG_00000020-scaffold_10_21 leader / core peptide: MSHLSVIRAWRDEDYRASLTPEQQSTLPENPAGLIALSEAGLGRVQGG - LVRPEDhbLQPGNCDhbEFDhbRNCPDhaICQVFDhaC
allorf_030132_030245 leader / core peptide: VWIFFELGAMKITAS - PDhaDhbGIRFLARPKDhbRRVCWRLAK

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000020-scaffold_10_22 - Putative Class II

TARA_SAMEA6034818_MAG_00000020-scaffold_10_21 leader / core peptide: MSHLSVIRAWRDEDYRASLTPEQQSTLPENPAGLIALSEAGLGRVQGG - LVRPEDhbLQPGNCDhbEFDhbRNCPDhaICQVFDhaC
allorf_030132_030245 leader / core peptide: VWIFFELGAMKITAS - PDhaDhbGIRFLARPKDhbRRVCWRLAK
allorf_042959_043060 leader / core peptide: VARWRGVARLAVCGA - DhbVRWDhaDhaCGPMDhaDhaRRRNRP
allorf_030080_030313 leader / core peptide: LQRALARGHPQNRRNAALNPRRIHLAKRQHTRRVFGRARNLIPVEGDAVIFIA - PDhaDhaKNIHDhbRHGPFQEEKFGCVKLF
allorf_043029_043244 leader / core peptide: LHRVILAGSGRVSLTGKNHRPRPACMFSVISKTAPDVSSNNREQPRARTTTGA - DhaGHDhaRRYPVRAGCGAGDhaDhb

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_10_21 - Class II

Cleavage pHMM score: -1.50

RODEO score: 0

Monoisotopic mass: 3051.5 Da

Molecular weight: 3053.5 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3071.5 Da N = 1

allorf_030132_030245 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 2557.5 Da

Molecular weight: 2559.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2577.1 Da N = 1; 2595.1 Da N = 2

allorf_042959_043060 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 2042.1 Da

Molecular weight: 2043.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2061.3 Da N = 1; 2079.4 Da N = 2; 2097.4 Da N = 3; 2115.4 Da N = 4

allorf_030080_030313 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 2731.4 Da

Molecular weight: 2733.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2751.1 Da N = 1; 2769.1 Da N = 2

allorf_043029_043244 - Class II

Cleavage pHMM score: -3.80

RODEO score: 0

Monoisotopic mass: 1745.9 Da

Molecular weight: 1746.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1764.9 Da N = 1; 1782.9 Da N = 2; 1801.0 Da N = 3

TARA_SAMEA6034818_MAG_00000020-scaffold_10_21 - Class II

Cleavage pHMM score: -1.50

RODEO score: 0

Monoisotopic mass: 3051.5 Da

Molecular weight: 3053.5 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3071.5 Da N = 1

allorf_030132_030245 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 2557.5 Da

Molecular weight: 2559.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2577.1 Da N = 1; 2595.1 Da N = 2

TARA_SAMEA6034818_MAG_00000020-scaffold_10 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 135,008 - 181,733 nt. (total: 46,726 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 135007 - 181733:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_10_115

Search NORINE for peptide: strict or relaxed

CAL_domain (174..488): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 128.0
NH2: 33.2
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1138..1532): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAhifGCVtK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_11 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 8,295 - 85,705 nt. (total: 77,411 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 8294 - 85705:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (X - orn - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 8294 - 52583:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 36099 - 85705:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - orn - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_11_22

Search NORINE for peptide: strict or relaxed

AMP-binding (514..905): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmiMLGMVcK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_11_42

Search NORINE for peptide: strict or relaxed

AMP-binding (226..629): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDgtFSLmeK
Nearest Stachelhaus code:: beta-ala
Stachelhaus code match:: 60% (weak)

AMP-binding (1283..1689): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVgDVGAvaK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (2352..2755): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvQFwGyAVK
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_12 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 20,893 - 44,117 nt. (total: 23,225 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000020-scaffold_12_22 - Putative Class II

TARA_SAMEA6034818_MAG_00000020-scaffold_12_21 leader / core peptide: MSHVDVIRAWKDPDYRRGLSEAQLAELPANPAGDMALTNEQLKEFSGG - KPIVDhbDhbAIDhbCDhbRDhaDhbFLGWKACCP
allorf_030401_030547 leader / core peptide: VNASWLKSRLGTVIYT - GDhaGADWIVKDhaRVAAANDRDCDDhaRHLADhbLADhbIR
allorf_030450_030536 leader / core peptide: MVKEPIRDGYLYG - VRRGLDCKIDhbGCRRQ
allorf_040795_040872 leader / core peptide: MTSRPSKMPLEDRLSSRGG - RGCVVDha

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_12_21 - Class II

Cleavage pHMM score: -4.80

RODEO score: 0

Monoisotopic mass: 2388.3 Da

Molecular weight: 2389.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2407.9 Da N = 1; 2425.9 Da N = 2; 2443.9 Da N = 3

allorf_030401_030547 - Class II

Cleavage pHMM score: -4.40

RODEO score: 0

Monoisotopic mass: 3334.7 Da

Molecular weight: 3336.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3354.7 Da N = 1; 3372.7 Da N = 2; 3390.7 Da N = 3; 3408.8 Da N = 4

allorf_030450_030536 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 1741.9 Da

Molecular weight: 1743.1 Da

Number of bridges: 1

allorf_040795_040872 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 601.3 Da

Molecular weight: 601.7 Da

Number of bridges: 1

TARA_SAMEA6034818_MAG_00000020-scaffold_13 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 70,117 - 82,039 nt. (total: 11,923 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000020-scaffold_13 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 131,117 - 192,067 nt. (total: 60,951 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 131116 - 192067:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu - val - X - X - ile - leu - val - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_13_106

Search NORINE for peptide: strict or relaxed

AMP-binding (1079..1471): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAaFwGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 80% (moderate)

AMP-binding (2141..2542): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWlGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (3204..3611): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmEnIGaVtK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

AMP-binding (4279..4686): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVqsVGAIsK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (5443..5845): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFlGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (6507..6898): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAgFwGNVlK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

AMP-binding (7647..8044): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DvLWLGGTyK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (8716..9113): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAgFwGvVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_14 - Region 1 - NRPS,T1PKS,lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 12 - 183,056 nt. (total: 183,045 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Module view

Legend

Lanthipeptides

NRPS/PKS products

NRPS/PKS monomers

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 11 - 183056:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (orn - asp - ala - asn - gln - leu - X) + (glu - leu - X - ala - X) + (glu - val) + (ser - asp) + (mal - D-ile - X) + (ccmal - tyr - ccmal - ala - leu - X - ala - X - X - pro - ile - X - X - ser) + (thr - ala-b - cys - X) + (X - cys) + (cys) + (tyr - X - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 11 - 84986:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (orn - asp - ala - asn - gln - leu - X) + (glu - leu - X - ala - X) + (glu - val) + (ser - asp) + (mal - D-ile - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 72643 - 183056:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr - X - ccmal) + (cys) + (X - cys) + (thr - ala-b - cys - X) + (ccmal - tyr - ccmal - ala - leu - X - ala - X - X - pro - ile - X - X - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_14_2

Search NORINE for peptide: strict or relaxed

AMP-binding (496..909): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGElvSVDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 80% (moderate)

AMP-binding (1574..1972): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DtKDLGlVDK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

AMP-binding (2632..3019): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3678..4078): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVaK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

AMP-binding (4741..5134): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLvqK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

AMP-binding (5794..6183): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (6841..7235): X

NRPSPredictor2: glu, gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQyGLvqK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_3

Search NORINE for peptide: strict or relaxed

AMP-binding (475..869): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGlVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 90% (moderate)

AMP-binding (1527..1916): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFqGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (2573..2972): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (3637..4024): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (4686..5096): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmEnIGaVtK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_5

Search NORINE for peptide: strict or relaxed

AMP-binding (435..844): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAEnIGaVtK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 70% (weak)

AMP-binding (1510..1911): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_6

Search NORINE for peptide: strict or relaxed

AMP-binding (514..918): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWNiAlVHK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

AMP-binding (1587..1988): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_7

Search NORINE for peptide: strict or relaxed

PKS_AT (528..806): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.7
inactive: 78.0
Methoxymalonyl-CoA: 56.0
Methylmalonyl-CoA: 48.2
Propionyl-CoA: 41.0
2-Methylbutyryl-CoA: 27.2
CHC-CoA: 23.9
Ethylmalonyl-CoA: 23.7
trans-1,2-CPDA: 16.9
fatty_acid: 14.9
Acetyl-CoA: 14.9
Benzoyl-CoA: 14.8
Isobutyryl-CoA: 9.7
3-Methylbutyryl-CoA: 8.6

AMP-binding (1950..2348): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTyK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (3484..3871): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAyTtAAVwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_20

Search NORINE for peptide: strict or relaxed

PKS_AT (549..837): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; 2-Methylbutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.4
inactive: 89.8
Methoxymalonyl-CoA: 86.8
Methylmalonyl-CoA: 76.9
Propionyl-CoA: 71.6
Ethylmalonyl-CoA: 56.8
2-Methylbutyryl-CoA: 43.1
CHC-CoA: 38.7
Isobutyryl-CoA: 32.0
fatty_acid: 27.3
Benzoyl-CoA: 25.2
trans-1,2-CPDA: 24.7
Acetyl-CoA: 18.3
3-Methylbutyryl-CoA: 8.4

AMP-binding (1994..2393): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

PKS_AT (3115..3409): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.4
inactive: 86.6
Methoxymalonyl-CoA: 67.4
Methylmalonyl-CoA: 56.4
Propionyl-CoA: 47.3
CHC-CoA: 34.0
Isobutyryl-CoA: 31.5
Ethylmalonyl-CoA: 25.0
2-Methylbutyryl-CoA: 19.1
trans-1,2-CPDA: 13.4
fatty_acid: 10.7
3-Methylbutyryl-CoA: 9.5
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0

AMP-binding (4533..4922): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsLcLGagFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

AMP-binding (4946..5357): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (6025..6423): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (7092..7480): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (8131..8534): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAffIGAaYK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

AMP-binding (9197..9588): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (10249..10646): X

NRPSPredictor2: asp, asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIatVtK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 70% (weak)

AMP-binding (11302..11698): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGgTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (12372..12772): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFvAqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (13427..13829): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (14488..14888): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (15570..15972): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvyhLGfVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

AMP-binding (16633..17033): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_21

Search NORINE for peptide: strict or relaxed

AMP-binding (506..912): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1585..1987): ala-b

NRPSPredictor2: ala-b

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDWltSLADK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 80% (moderate)

AMP-binding (2655..3054): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (3714..4106): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAgTfGvICK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_22

Search NORINE for peptide: strict or relaxed

AMP-binding (463..863): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DSaLiAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

AMP-binding (1535..1937): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_24

Search NORINE for peptide: strict or relaxed

AMP-binding (536..938): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_14_25

Search NORINE for peptide: strict or relaxed

AMP-binding (500..897): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1561..1975): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSaLvAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

PKS_AT (2699..2991): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 132.5
inactive: 75.3
Methylmalonyl-CoA: 57.9
Methoxymalonyl-CoA: 57.4
Propionyl-CoA: 39.6
Ethylmalonyl-CoA: 32.8
2-Methylbutyryl-CoA: 27.3
CHC-CoA: 24.4
Isobutyryl-CoA: 19.2
Benzoyl-CoA: 15.2
trans-1,2-CPDA: 13.3
Acetyl-CoA: 12.9
fatty_acid: 12.7
3-Methylbutyryl-CoA: 0.0

TARA_SAMEA6034818_MAG_00000020-scaffold_17 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 37,867 - 66,615 nt. (total: 28,749 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000020-scaffold_18 - Region 1 - NRPS,ladderane,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 99,022 - 157,610 nt. (total: 58,589 nt) Show pHMM detection rules used

Region on contig edge.

ladderane: ladderane
NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 99021 - 157610:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 124843 - 157610:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_18_126

Search NORINE for peptide: strict or relaxed

AMP-binding (494..880): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_20 - Region 1 - NRPS,T1PKS,T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 80,316 nt. (total: 80,316 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 80316:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 38402:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 8050 - 59336:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 37604 - 80316:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_20_22

Search NORINE for peptide: strict or relaxed

AMP-binding (502..832): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFmrLGaAeK
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 60% (weak)

CAL_domain (1065..1499): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 17.1
AHBA: 7.9
NH2: 5.8
shikimic_acid: 0.0
Acetyl-CoA: 0.0

TARA_SAMEA6034818_MAG_00000020-scaffold_20_23

PKS_AT (538..818): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.7
inactive: 91.6
Methoxymalonyl-CoA: 75.3
Methylmalonyl-CoA: 70.9
Propionyl-CoA: 49.1
Ethylmalonyl-CoA: 40.6
Isobutyryl-CoA: 35.7
2-Methylbutyryl-CoA: 23.2
CHC-CoA: 19.9
trans-1,2-CPDA: 18.1
Benzoyl-CoA: 17.1
Acetyl-CoA: 12.9
fatty_acid: 11.2
3-Methylbutyryl-CoA: 11.2

TARA_SAMEA6034818_MAG_00000020-scaffold_20_36

Search NORINE for peptide: strict or relaxed

AMP-binding (538..871): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DAT---gaGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_23 - Region 1 - NRPS,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 74,443 nt. (total: 74,443 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 74443:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - Me-ccmal) + (mal - ccmal - ccmal - ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_23_2

Search NORINE for peptide: strict or relaxed

AMP-binding (8325..8634): orn

NRPSPredictor2: orn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_25 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 52,608 - 104,007 nt. (total: 51,400 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 52607 - 104007:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - ser - gly - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_25_57

Search NORINE for peptide: strict or relaxed

AMP-binding (32..427): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWlGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (1101..1492): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DiWHFGfINK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 80% (moderate)

AMP-binding (2159..2545): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (3198..3591): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWlGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_29 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 5,794 - 28,442 nt. (total: 22,649 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6034818_MAG_00000020-scaffold_29 - Region 2 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 62,516 - 88,427 nt. (total: 25,912 nt) Show pHMM detection rules used

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6034818_MAG_00000020-scaffold_32 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 41,807 nt. (total: 41,807 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 41807:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_32_13

Search NORINE for peptide: strict or relaxed

AMP-binding (301..691): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsaVVAGigK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_34 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 4,365 - 24,649 nt. (total: 20,285 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000020-scaffold_35 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 24,606 nt. (total: 24,606 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 24606:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_35_2

Search NORINE for peptide: strict or relaxed

AMP-binding (27..421): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_36 - Region 1 - lanthipeptide-class-v

Download region GenBank file

Download region SVG

Location: 1 - 49,859 nt. (total: 49,859 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6034818_MAG_00000020-scaffold_38 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 6,389 - 72,139 nt. (total: 65,751 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 6388 - 72139:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal - ccmal - ohmal - mal - mal - ohmal - ohmal - ccmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_39 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 26,043 - 36,930 nt. (total: 10,888 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000020-scaffold_40 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 66,417 nt. (total: 66,417 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 66417:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - X - X - ser - glu - ser - ser) + (X) + (ile - X - ala - X) + (ohmal) + (gly - ile) + (ile - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_40_1

Search NORINE for peptide: strict or relaxed

AMP-binding (539..942): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGaTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (1613..2007): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpLciGAVvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_40_2

Search NORINE for peptide: strict or relaxed

AMP-binding (523..913): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1578..1982): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_40_4

PKS_AT (533..817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 167.4
inactive: 107.6
Methoxymalonyl-CoA: 89.7
Methylmalonyl-CoA: 71.7
Propionyl-CoA: 42.7
Ethylmalonyl-CoA: 39.9
Isobutyryl-CoA: 37.7
Acetyl-CoA: 33.0
fatty_acid: 24.4
CHC-CoA: 23.6
Benzoyl-CoA: 22.1
trans-1,2-CPDA: 20.0
2-Methylbutyryl-CoA: 18.0
3-Methylbutyryl-CoA: 17.8

TARA_SAMEA6034818_MAG_00000020-scaffold_40_5

Search NORINE for peptide: strict or relaxed

AMP-binding (545..941): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWmGfTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1606..2003): X

NRPSPredictor2: val, ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAlhLGCTFK
Nearest Stachelhaus code:: val, ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (2679..3070): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3731..4129): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAYlhGGTyK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_40_6

Search NORINE for peptide: strict or relaxed

AMP-binding (544..948): X

NRPSPredictor2: orn, lys, arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAESfGtVnK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_40_7

Search NORINE for peptide: strict or relaxed

AMP-binding (21..412): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (1079..1474): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAflLGaTYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 70% (weak)

AMP-binding (2135..2532): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAylLGiTYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 70% (weak)

AMP-binding (3202..3599): ser

NRPSPredictor2: ser

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

AMP-binding (4267..4675): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DmRvnGtVtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

AMP-binding (5340..5739): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLvEK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

AMP-binding (6399..6794): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_41 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 8,290 - 64,270 nt. (total: 55,981 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 8289 - 64270:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - val - X) + (ile - X - ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_41_27

Search NORINE for peptide: strict or relaxed

AMP-binding (539..942): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFlGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (1614..1996): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAsTIAnIwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

AMP-binding (2665..3054): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3717..4138): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHwsfqaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_41_28

Search NORINE for peptide: strict or relaxed

AMP-binding (1028..1431): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYsLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (2100..2496): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWLGgVFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (3160..3565): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DieDIGtVaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_42 - Region 1 - LAP

Download region GenBank file

Download region SVG

Location: 7,055 - 30,707 nt. (total: 23,653 nt) Show pHMM detection rules used

LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000020-scaffold_45 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 39,100 nt. (total: 39,100 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 39100:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_45_1

Search NORINE for peptide: strict or relaxed

AMP-binding (2906..3312): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDgleSLADK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 70% (weak)

AMP-binding (4005..4399): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFqaNVgK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

AMP-binding (5061..5462): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWlGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_46 - Region 1 - NRPS,NRPS-like,T1PKS,betalactone

Download region GenBank file

Download region SVG

Location: 1 - 43,738 nt. (total: 43,738 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 43738:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (cys - cys) + (LDAP)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 41017:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (cys - cys) + (LDAP)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 0 - 33105:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (cys - cys) + (LDAP)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 1023 - 43738:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (cys - cys) + (LDAP)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_46_1

Search NORINE for peptide: strict or relaxed

AMP-binding (438..835): LDAP

NRPSPredictor2: LDAP

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDqAiVNK
Nearest Stachelhaus code:: LDAP
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_46_2

Search NORINE for peptide: strict or relaxed

AMP-binding (492..894): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1558..1956): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_46_4

PKS_AT (570..869): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.5
inactive: 143.6
Methoxymalonyl-CoA: 75.8
Methylmalonyl-CoA: 73.8
Propionyl-CoA: 49.0
Ethylmalonyl-CoA: 46.7
Isobutyryl-CoA: 43.8
CHC-CoA: 35.5
2-Methylbutyryl-CoA: 35.5
Benzoyl-CoA: 32.3
Acetyl-CoA: 28.4
trans-1,2-CPDA: 26.7
fatty_acid: 16.9
3-Methylbutyryl-CoA: 16.9

TARA_SAMEA6034818_MAG_00000020-scaffold_46_5

Search NORINE for peptide: strict or relaxed

AMP-binding (8..403): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: hcnFfAGpFK
Nearest Stachelhaus code:: iva
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_60 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 38,841 nt. (total: 38,841 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 38841:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_60_3

PKS_AT (552..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 173.7
inactive: 106.3
Methoxymalonyl-CoA: 70.7
Methylmalonyl-CoA: 63.9
Propionyl-CoA: 61.3
Ethylmalonyl-CoA: 38.7
2-Methylbutyryl-CoA: 31.5
CHC-CoA: 31.3
fatty_acid: 26.6
Isobutyryl-CoA: 22.0
Benzoyl-CoA: 19.4
trans-1,2-CPDA: 15.7
Acetyl-CoA: 10.4
3-Methylbutyryl-CoA: 10.3

TARA_SAMEA6034818_MAG_00000020-scaffold_60_4

Search NORINE for peptide: strict or relaxed

CAL_domain (41..490): pk

minowa: NH2

Prediction, score:

NH2: 201.8
fatty_acid: 18.6
AHBA: 14.8
shikimic_acid: 0.0
Acetyl-CoA: -0.2

AMP-binding (1175..1571): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQwGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

PKS_AT (2301..2591): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.9
inactive: 123.6
Methoxymalonyl-CoA: 70.4
Methylmalonyl-CoA: 60.6
Propionyl-CoA: 46.2
Isobutyryl-CoA: 39.6
fatty_acid: 31.6
Ethylmalonyl-CoA: 29.7
Benzoyl-CoA: 28.2
2-Methylbutyryl-CoA: 24.9
CHC-CoA: 20.1
trans-1,2-CPDA: 10.9
Acetyl-CoA: 9.2
3-Methylbutyryl-CoA: 0.0

TARA_SAMEA6034818_MAG_00000020-scaffold_60_6

Search NORINE for peptide: strict or relaxed

AMP-binding (17..446): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: --fFIAppVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6034818_MAG_00000020-scaffold_61 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 24,783 nt. (total: 24,783 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 24783:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_61_1

Search NORINE for peptide: strict or relaxed

AMP-binding (459..848): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKiGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6034818_MAG_00000020-scaffold_61_13

PKS_AT (0..280): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 76.8
Methoxymalonyl-CoA: 21.2
Methylmalonyl-CoA: 17.0
Propionyl-CoA: 14.1
inactive: 14.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TARA_SAMEA6034818_MAG_00000020-scaffold_62 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 14,999 - 42,391 nt. (total: 27,393 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6034818_MAG_00000020-scaffold_69 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 25,696 nt. (total: 25,696 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25696:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000020-scaffold_69_2

Search NORINE for peptide: strict or relaxed

AMP-binding (557..968): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1624..2022): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000020-scaffold_71 - Region 1 - thiopeptide

Download region GenBank file

Download region SVG

Location: 1 - 23,843 nt. (total: 23,843 nt) Show pHMM detection rules used

Region on contig edge.

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Thiopeptides

Thiopeptide predictions

No core peptides found.

Thiopeptides

Core peptide predictions

No core peptides found.