Sperfeld_V5Y_2_polished - 43 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

contig_1

Region	Type	From	To
Region 1	NRPS,RRE-containing	192,615	306,636
Region 2	NRPS	350,180	386,253
Region 3	NRPS,T1PKS	502,356	600,789
Region 4	RRE-containing	1,191,243	1,210,652
Region 5	NRPS,T1PKS	1,267,706	1,388,241
Region 6	thioamitides	1,410,670	1,433,439
Region 7	T3PKS	1,520,909	1,561,976
Region 8	PKS-like	2,098,390	2,139,634
Region 9	NRPS,T1PKS	2,145,692	2,197,011
Region 10	hserlactone	2,246,403	2,267,338
Region 11	NRPS-like	2,348,787	2,390,983
Region 12	transAT-PKS,T1PKS	2,895,059	2,986,670
Region 13	NRPS	3,275,509	3,316,553
Region 14	transAT-PKS-like	3,490,432	3,540,263
Region 15	NRPS,T1PKS	3,649,914	3,706,805
Region 16	T1PKS,NRPS	3,883,004	3,934,698
Region 17	hglE-KS	3,957,399	4,008,571
Region 18	NRPS,T1PKS	4,624,537	4,685,463
Region 19	NRPS-like	4,844,020	4,886,768
Region 20	hglE-KS	5,355,824	5,410,197
Region 21	NRPS-like,transAT-PKS,NRPS	6,064,588	6,207,568
Region 22	NRPS-like	6,870,493	6,911,747
Region 23	lassopeptide,RRE-containing	6,994,565	7,018,297
Region 24	ranthipeptide	7,442,357	7,463,778
Region 25	T1PKS,NRPS-like,NRPS	7,470,624	7,589,006
Region 26	hglE-KS,T1PKS	7,628,908	7,680,496
Region 27	terpene	7,698,118	7,719,998
Region 28	arylpolyene,NRPS,T1PKS	7,809,362	7,940,411
Region 29	T1PKS,NRPS-like	7,953,237	8,003,147
Region 30	T1PKS,NRPS,NRPS-like	8,035,264	8,185,043
Region 31	NRPS	8,919,496	8,965,705
Region 32	transAT-PKS	9,037,620	9,130,846
Region 33	NRPS,T1PKS	9,357,129	9,434,399
Region 34	NRPS	9,490,740	9,535,765
Region 35	RiPP-like	9,583,122	9,592,377
Region 36	transAT-PKS-like,NRPS	9,616,365	9,755,230
Region 37	NRPS,T1PKS	9,862,096	9,927,177
Region 38	RiPP-like	10,013,793	10,026,252
Region 39	NRPS,T1PKS	10,039,951	10,207,935
Region 40	NRPS	10,450,475	10,506,458
Region 41	NAGGN	10,715,539	10,730,363
Region 42	NRPS	10,848,844	10,892,932
Region 43	arylpolyene	10,920,568	10,964,437

contig_1 - Region 1 - NRPS,RRE-containing

Download region GenBank file

Download region SVG

Location: 192,615 - 306,636 nt. (total: 114,022 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 192614 - 306636:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr) + (X - pro) + (D-X - orn - X - gly - thr) + (D-asn - D-asn - X - orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 192614 - 234019:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 239619 - 306636:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - pro) + (D-X - orn - X - gly - thr) + (D-asn - D-asn - X - orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_00745

Search NORINE for peptide: strict or relaxed

AMP-binding (249..640): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

KJCGBG_00895

Search NORINE for peptide: strict or relaxed

AMP-binding (461..842): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DtESIGSVCK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 90% (moderate)

AMP-binding (1478..1872): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

KJCGBG_00900

Search NORINE for peptide: strict or relaxed

AMP-binding (250..634): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAyTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 90% (moderate)

AMP-binding (1707..2107): orn

NRPSPredictor2: orn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

AMP-binding (2772..3170): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGfiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 60% (weak)

AMP-binding (3832..4215): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGmVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (4886..5295): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

KJCGBG_00905

Search NORINE for peptide: strict or relaxed

AMP-binding (264..650): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1742..2134): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3785..4254): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (4912..5320): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

contig_1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 350,180 - 386,253 nt. (total: 36,074 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 5, location 350179 - 386253:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_01045

Search NORINE for peptide: strict or relaxed

AMP-binding (526..920): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpENiGaItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (1589..1988): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

contig_1 - Region 3 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 502,356 - 600,789 nt. (total: 98,434 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 6, location 502355 - 600789:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - X - D-orn) + (asp - D-asp - pro) + (X - X) + (ohmal) + (gly) + (gly - ser) + (ser - X) + (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_01455

CAL_domain (45..490): pk

minowa: NH2

Prediction, score:

NH2: 121.5
AHBA: 14.6
shikimic_acid: 0.0
fatty_acid: -1.2
Acetyl-CoA: -1.8

KJCGBG_01460

Search NORINE for peptide: strict or relaxed

PKS_AT (579..873): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.6
inactive: 143.1
Methoxymalonyl-CoA: 69.2
Methylmalonyl-CoA: 62.9
Isobutyryl-CoA: 42.5
Propionyl-CoA: 36.4
2-Methylbutyryl-CoA: 35.3
CHC-CoA: 31.4
Benzoyl-CoA: 30.5
Ethylmalonyl-CoA: 25.7
Acetyl-CoA: 19.5
fatty_acid: 16.8
trans-1,2-CPDA: 16.3
3-Methylbutyryl-CoA: 8.7

AMP-binding (2216..2611): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVAqVGAvtK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (3269..3686): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVtSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 90% (moderate)

KJCGBG_01465

Search NORINE for peptide: strict or relaxed

AMP-binding (490..888): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKiGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

AMP-binding (1636..2036): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (3152..3558): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQYIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

KJCGBG_01470

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVwhIGSIaK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

AMP-binding (1523..1914): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DqcHrvsgDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 40% (weak)

KJCGBG_01475

PKS_AT (535..818): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.4
inactive: 115.5
Methoxymalonyl-CoA: 61.7
Methylmalonyl-CoA: 46.7
Propionyl-CoA: 35.9
2-Methylbutyryl-CoA: 23.2
Ethylmalonyl-CoA: 20.1
CHC-CoA: 19.9
Isobutyryl-CoA: 17.1
Acetyl-CoA: 11.7
Benzoyl-CoA: 10.8
3-Methylbutyryl-CoA: 8.9
fatty_acid: 8.0
trans-1,2-CPDA: 0.0

KJCGBG_01480

Search NORINE for peptide: strict or relaxed

AMP-binding (507..904): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

KJCGBG_01485

Search NORINE for peptide: strict or relaxed

AMP-binding (508..903): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1656..2055): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

KJCGBG_01490

Search NORINE for peptide: strict or relaxed

AMP-binding (544..940): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1596..1998): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiEnVGTviK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 60% (weak)

KJCGBG_01495

Search NORINE for peptide: strict or relaxed

AMP-binding (513..924): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

contig_1 - Region 4 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1,191,243 - 1,210,652 nt. (total: 19,410 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

contig_1 - Region 5 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1,267,706 - 1,388,241 nt. (total: 120,536 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 8, location 1267705 - 1388241:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ala - X) + (gly - cys - ccmal) + (X) + (asn) + (asn - D-ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 1267705 - 1351175:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - cys - ccmal) + (X) + (asn) + (asn - D-ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 1337297 - 1388241:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_03590

Search NORINE for peptide: strict or relaxed

AMP-binding (19..412): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DynatTmrSK
Nearest Stachelhaus code:: dab
Stachelhaus code match:: 40% (weak)

KJCGBG_03640

CAL_domain (674..1117): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 31.0
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

KJCGBG_03655

Search NORINE for peptide: strict or relaxed

AMP-binding (436..836): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1515..1917): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

KJCGBG_03660

Search NORINE for peptide: strict or relaxed

AMP-binding (448..849): asn

NRPSPredictor2: asn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

KJCGBG_03670

Search NORINE for peptide: strict or relaxed

AMP-binding (446..856): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAenIGAItK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

KJCGBG_03685

Search NORINE for peptide: strict or relaxed

AMP-binding (535..935): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1603..2003): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

PKS_AT (3035..3331): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.1
inactive: 99.3
Methoxymalonyl-CoA: 73.2
Methylmalonyl-CoA: 54.1
Propionyl-CoA: 44.0
Isobutyryl-CoA: 29.5
fatty_acid: 28.7
Ethylmalonyl-CoA: 27.8
trans-1,2-CPDA: 26.1
2-Methylbutyryl-CoA: 25.8
CHC-CoA: 25.3
3-Methylbutyryl-CoA: 15.3
Benzoyl-CoA: 14.1
Acetyl-CoA: 13.2

KJCGBG_03760

Search NORINE for peptide: strict or relaxed

CAL_domain (45..476): pk

minowa: NH2

Prediction, score:

NH2: 144.0
fatty_acid: 22.4
AHBA: 12.4
Acetyl-CoA: 6.1
shikimic_acid: 0.0

AMP-binding (1161..1553): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2218..2610): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3270..3679): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRnfilraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 40% (weak)

contig_1 - Region 6 - thioamitides

Download region GenBank file

Download region SVG

Location: 1,410,670 - 1,433,439 nt. (total: 22,770 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

contig_1 - Region 7 - T3PKS

Download region GenBank file

Download region SVG

Location: 1,520,909 - 1,561,976 nt. (total: 41,068 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

contig_1 - Region 8 - PKS-like

Download region GenBank file

Download region SVG

Location: 2,098,390 - 2,139,634 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

contig_1 - Region 9 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 2,145,692 - 2,197,011 nt. (total: 51,320 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 14, location 2145691 - 2197011:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - X) + (mal) + (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_06180

Search NORINE for peptide: strict or relaxed

AMP-binding (546..964): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1631..2020): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGlLsAvVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

KJCGBG_06185

PKS_AT (520..816): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.2
Methylmalonyl-CoA: 47.9
inactive: 42.0
Methoxymalonyl-CoA: 41.9
2-Methylbutyryl-CoA: 24.9
CHC-CoA: 19.0
trans-1,2-CPDA: 16.3
Ethylmalonyl-CoA: 16.0
Benzoyl-CoA: 15.3
Propionyl-CoA: 15.1
Isobutyryl-CoA: 15.0
fatty_acid: 12.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

KJCGBG_06190

Search NORINE for peptide: strict or relaxed

AMP-binding (528..918): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DImQcGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

contig_1 - Region 10 - hserlactone

Download region GenBank file

Download region SVG

Location: 2,246,403 - 2,267,338 nt. (total: 20,936 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

contig_1 - Region 11 - NRPS-like

Download region GenBank file

Download region SVG

Location: 2,348,787 - 2,390,983 nt. (total: 42,197 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 16, location 2348786 - 2390983:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_06800

Search NORINE for peptide: strict or relaxed

AMP-binding (36..419): X

NRPSPredictor2: tyr, bht

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAsDvGVVcK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

contig_1 - Region 12 - T1PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 2,895,059 - 2,986,670 nt. (total: 91,612 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 17, location 2895058 - 2986670:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ccmal - mal) + (Me-ohmal - mal - ccmal - ccmal - ohmal - Me-ohmal - Me-mal - ccmal) + (ccmal - mal - ohmal)
Non-colinear ordering:: KJCGBG_08490 + KJCGBG_08495 + KJCGBG_08500 + KJCGBG_08510 + KJCGBG_08505

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_08510

PKS_AT (4..277): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 116.5
inactive: 52.0
Methoxymalonyl-CoA: 43.5
Propionyl-CoA: 35.1
Methylmalonyl-CoA: 32.4
fatty_acid: 12.7
Benzoyl-CoA: 12.0
Isobutyryl-CoA: 11.6
2-Methylbutyryl-CoA: 10.7
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

contig_1 - Region 13 - NRPS

Download region GenBank file

Download region SVG

Location: 3,275,509 - 3,316,553 nt. (total: 41,045 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

contig_1 - Region 14 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 3,490,432 - 3,540,263 nt. (total: 49,832 nt) Show pHMM detection rules used

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

contig_1 - Region 15 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 3,649,914 - 3,706,805 nt. (total: 56,892 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 20, location 3649913 - 3706805:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - X - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_10880

Search NORINE for peptide: strict or relaxed

CAL_domain (44..485): pk

minowa: NH2

Prediction, score:

NH2: 13.3
Acetyl-CoA: 3.1
AHBA: 2.5
fatty_acid: 1.9
shikimic_acid: -1.8

AMP-binding (1174..1584): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DfitVGiLfK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 50% (weak)

AMP-binding (2812..3205): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAfigGLVDK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

PKS_AT (3942..4238): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.0
inactive: 65.0
Methylmalonyl-CoA: 57.3
Methoxymalonyl-CoA: 57.3
Propionyl-CoA: 39.4
Benzoyl-CoA: 31.4
Isobutyryl-CoA: 31.3
Ethylmalonyl-CoA: 27.8
2-Methylbutyryl-CoA: 24.7
fatty_acid: 23.4
CHC-CoA: 18.6
Acetyl-CoA: 18.2
3-Methylbutyryl-CoA: 17.7
trans-1,2-CPDA: 13.0

KJCGBG_10885

Search NORINE for peptide: strict or relaxed

AMP-binding (554..955): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFvAqvAK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

contig_1 - Region 16 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 3,883,004 - 3,934,698 nt. (total: 51,695 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 21, location 3883003 - 3934698:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ohmal) + (X - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_11595

Search NORINE for peptide: strict or relaxed

AMP-binding (478..871): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

PKS_AT (1596..1901): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 165.1
inactive: 123.2
Methoxymalonyl-CoA: 62.5
Methylmalonyl-CoA: 44.5
Propionyl-CoA: 36.2
fatty_acid: 33.7
3-Methylbutyryl-CoA: 20.0
Ethylmalonyl-CoA: 16.4
Isobutyryl-CoA: 15.7
CHC-CoA: 12.9
Acetyl-CoA: 12.6
2-Methylbutyryl-CoA: 11.1
Benzoyl-CoA: 9.4
trans-1,2-CPDA: 0.0

KJCGBG_11600

Search NORINE for peptide: strict or relaxed

AMP-binding (541..922): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: eAWyInlgaK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

PKS_AT (1659..1945): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.9
inactive: 88.3
Methoxymalonyl-CoA: 53.4
Methylmalonyl-CoA: 42.9
Propionyl-CoA: 30.7
Acetyl-CoA: 23.9
Benzoyl-CoA: 11.1
Isobutyryl-CoA: 10.8
trans-1,2-CPDA: 9.7
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

contig_1 - Region 17 - hglE-KS

Download region GenBank file

Download region SVG

Location: 3,957,399 - 4,008,571 nt. (total: 51,173 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 22, location 3957398 - 4008571:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_11780

PKS_AT (1217..1506): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 45.7
inactive: 30.8
Methoxymalonyl-CoA: 24.9
Methylmalonyl-CoA: 21.9
trans-1,2-CPDA: 9.8
Propionyl-CoA: 4.5
Ethylmalonyl-CoA: 1.3
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
CHC-CoA: -0.6

KJCGBG_11785

PKS_AT (637..836): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 9.0
Malonyl-CoA: 4.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

contig_1 - Region 18 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 4,624,537 - 4,685,463 nt. (total: 60,927 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 23, location 4624536 - 4685463:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - thr - NMe-gly - phe - asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_14195

Search NORINE for peptide: strict or relaxed

CAL_domain (49..486): pk

minowa: NH2

Prediction, score:

NH2: 25.2
fatty_acid: 8.8
Acetyl-CoA: 8.1
AHBA: 7.8
shikimic_acid: 0.0

PKS_AT (1275..1566): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.2
inactive: 112.5
Methoxymalonyl-CoA: 72.3
Methylmalonyl-CoA: 65.0
Isobutyryl-CoA: 39.6
Propionyl-CoA: 39.4
Acetyl-CoA: 30.2
Ethylmalonyl-CoA: 28.8
2-Methylbutyryl-CoA: 23.9
CHC-CoA: 18.8
trans-1,2-CPDA: 10.7
3-Methylbutyryl-CoA: 5.7
fatty_acid: 0.0
Benzoyl-CoA: -3.2

AMP-binding (3200..3604): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (4261..4657): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (5715..6103): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTVAAVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 100% (strong)

AMP-binding (6771..7163): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DfTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

contig_1 - Region 19 - NRPS-like

Download region GenBank file

Download region SVG

Location: 4,844,020 - 4,886,768 nt. (total: 42,749 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 24, location 4844019 - 4886768:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_14940

Search NORINE for peptide: strict or relaxed

AMP-binding (52..439): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DtmVvGAVfK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

contig_1 - Region 20 - hglE-KS

Download region GenBank file

Download region SVG

Location: 5,355,824 - 5,410,197 nt. (total: 54,374 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 25, location 5355823 - 5410197:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_16790

PKS_AT (601..896): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 58.3%; Ethylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 83.9
Methoxymalonyl-CoA: 66.1
Methylmalonyl-CoA: 52.3
inactive: 31.8
CHC-CoA: 22.3
Propionyl-CoA: 21.2
Isobutyryl-CoA: 20.6
fatty_acid: 13.3
Acetyl-CoA: 11.1
2-Methylbutyryl-CoA: 9.7
Ethylmalonyl-CoA: 9.4
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

KJCGBG_16830

Search NORINE for peptide: strict or relaxed

AMP-binding (81..520): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vTyyVGTgiK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 50% (weak)

contig_1 - Region 21 - NRPS,NRPS-like,transAT-PKS

Download region GenBank file

Download region SVG

Location: 6,064,588 - 6,207,568 nt. (total: 142,981 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 26, location 6064587 - 6207568:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal) + (ccmal - ccmal - ohmal - OMe-mal - mal - ser - mal - Me-ccmal - Me-ohmal - ccmal - ccmal) + (OMe-mal - Me-ccmal - ohmal) + (mal - ohmal - ohmal - mal)
Non-colinear ordering:: KJCGBG_19225 + KJCGBG_19230 + KJCGBG_19235 + KJCGBG_19260 + KJCGBG_19215

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 27, location 6064587 - 6111105:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ohmal - OMe-mal - mal - ser - mal - Me-ccmal - Me-ohmal - ccmal - ccmal) + (mal - ccmal) + (ser - mal - ohmal - mal - ccmal - ohmal) + (mal - ohmal - ohmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 28, location 6103500 - 6207568:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal) + (ccmal - ccmal - ohmal - OMe-mal - mal - ser - mal - Me-ccmal - Me-ohmal - ccmal - ccmal) + (OMe-mal - Me-ccmal - ohmal)
Non-colinear ordering:: KJCGBG_19225 + KJCGBG_19230 + KJCGBG_19235 + KJCGBG_19260

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_19220

Search NORINE for peptide: strict or relaxed

AMP-binding (1..358): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

KJCGBG_19230

Search NORINE for peptide: strict or relaxed

AMP-binding (6653..7046): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

KJCGBG_19260

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 80.1
Methoxymalonyl-CoA: 22.1
Methylmalonyl-CoA: 19.2
inactive: 17.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

contig_1 - Region 22 - NRPS-like

Download region GenBank file

Download region SVG

Location: 6,870,493 - 6,911,747 nt. (total: 41,255 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

contig_1 - Region 23 - RRE-containing,lassopeptide

Download region GenBank file

Download region SVG

Location: 6,994,565 - 7,018,297 nt. (total: 23,733 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptide(s) for KJCGBG_22310 - Putative Class II

KJCGBG_22310 leader / core peptide / cleaved tail: MVMEKRVTSEVEDQTQGKKTYEKPLLVSRGDVATLTQ - AGFNAGSDSKATGELVQSS

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Lasso peptides

Core peptide predictions

KJCGBG_22310 - Class II: Cleavage pHMM score: 5.50; RODEO score: 21; Monoisotopic mass: 1806.8 Da; Molecular weight: 1807.9 Da; Number of bridges: 0

contig_1 - Region 24 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 7,442,357 - 7,463,778 nt. (total: 21,422 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

contig_1 - Region 25 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 7,470,624 - 7,589,006 nt. (total: 118,383 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 33, location 7470623 - 7589006:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal) + (redmal) + (redmal - Me-ccmal - Me-ccmal) + (X) + (X - X - pro - gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 34, location 7470623 - 7531950:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal) + (redmal) + (redmal - Me-ccmal - Me-ccmal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 35, location 7496746 - 7537820:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (redmal - Me-ccmal - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 36, location 7533892 - 7589006:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - pro - gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_23875

PKS_AT (101..404): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.6
inactive: 114.8
Methoxymalonyl-CoA: 81.0
Propionyl-CoA: 75.0
Methylmalonyl-CoA: 72.7
Ethylmalonyl-CoA: 43.7
2-Methylbutyryl-CoA: 34.7
Isobutyryl-CoA: 30.4
trans-1,2-CPDA: 27.9
CHC-CoA: 27.9
fatty_acid: 17.0
Benzoyl-CoA: 11.8
Acetyl-CoA: 11.6
3-Methylbutyryl-CoA: 9.0

KJCGBG_23880

PKS_AT (544..821): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 162.1
inactive: 94.1
Methoxymalonyl-CoA: 83.5
Methylmalonyl-CoA: 82.3
Propionyl-CoA: 62.1
Ethylmalonyl-CoA: 50.5
Isobutyryl-CoA: 49.9
Benzoyl-CoA: 36.3
2-Methylbutyryl-CoA: 35.7
trans-1,2-CPDA: 27.1
CHC-CoA: 21.2
Acetyl-CoA: 14.4
3-Methylbutyryl-CoA: 7.8
fatty_acid: 0.0

KJCGBG_23885

PKS_AT (551..821): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 160.1
inactive: 103.5
Methoxymalonyl-CoA: 60.1
Methylmalonyl-CoA: 58.7
Isobutyryl-CoA: 47.3
Propionyl-CoA: 34.2
Benzoyl-CoA: 23.4
3-Methylbutyryl-CoA: 14.6
Ethylmalonyl-CoA: 13.5
2-Methylbutyryl-CoA: 13.3
CHC-CoA: 8.8
Acetyl-CoA: 8.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0

PKS_AT (2547..2846): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 160.5
Methoxymalonyl-CoA: 134.1
Ethylmalonyl-CoA: 127.5
2-Methylbutyryl-CoA: 97.6
Isobutyryl-CoA: 94.5
trans-1,2-CPDA: 87.6
Benzoyl-CoA: 83.9
Malonyl-CoA: 74.8
Propionyl-CoA: 68.0
Acetyl-CoA: 56.9
CHC-CoA: 42.6
3-Methylbutyryl-CoA: 33.8
fatty_acid: 22.6
inactive: 14.5

PKS_AT (4243..4542): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Methoxymalonyl-CoA: 75.0%; Malonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 148.2
Methoxymalonyl-CoA: 126.2
Ethylmalonyl-CoA: 121.4
Isobutyryl-CoA: 90.3
2-Methylbutyryl-CoA: 80.5
Malonyl-CoA: 71.9
trans-1,2-CPDA: 70.4
Benzoyl-CoA: 61.9
CHC-CoA: 55.9
Propionyl-CoA: 54.4
Acetyl-CoA: 51.2
3-Methylbutyryl-CoA: 47.4
inactive: 26.1
fatty_acid: 24.0

KJCGBG_23890

Search NORINE for peptide: strict or relaxed

AMP-binding (5..410): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gLnvvSLsvK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 40% (weak)

KJCGBG_23995

Search NORINE for peptide: strict or relaxed

AMP-binding (545..960): X

NRPSPredictor2: glu, gln

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAeDIGtVvK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

AMP-binding (1620..2018): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVldAgHVnK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 60% (weak)

AMP-binding (2674..3077): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAqvAK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (3733..4129): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQiGaIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

contig_1 - Region 26 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 7,628,908 - 7,680,496 nt. (total: 51,589 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 37, location 7628907 - 7680496:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 38, location 7628907 - 7676086:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 39, location 7636627 - 7680496:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_24195

PKS_AT (1219..1508): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 49.7
Methoxymalonyl-CoA: 30.5
Methylmalonyl-CoA: 22.8
Propionyl-CoA: 19.5
inactive: 19.2
CHC-CoA: 11.4
trans-1,2-CPDA: 10.6
Ethylmalonyl-CoA: 9.9
2-Methylbutyryl-CoA: 7.7
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

KJCGBG_24200

PKS_AT (620..831): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

contig_1 - Region 27 - terpene

Download region GenBank file

Download region SVG

Location: 7,698,118 - 7,719,998 nt. (total: 21,881 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

contig_1 - Region 28 - NRPS,T1PKS,arylpolyene

Download region GenBank file

Download region SVG

Location: 7,809,362 - 7,940,411 nt. (total: 131,050 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)
NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 41, location 7809361 - 7940411:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - X - pro) + (ala) + (ile - X - ile - ala) + (val - D-thr - ile - lys - ala - NMe-gly - D-leu) + (pro - thr - pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 43, location 7834844 - 7940411:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - X - pro) + (ala) + (ile - X - ile - ala) + (val - D-thr - ile - lys - ala - NMe-gly - D-leu) + (pro - thr - pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_24780

Search NORINE for peptide: strict or relaxed

AMP-binding (126..292): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iyFv---LfK
Nearest Stachelhaus code:: phg
Stachelhaus code match:: 30% (weak)

KJCGBG_24810

Search NORINE for peptide: strict or relaxed

AMP-binding (161..578): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: phe, trp
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: mmwgStygGK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 30% (weak)

KJCGBG_24840

Search NORINE for peptide: strict or relaxed

CAL_domain (56..482): pk

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 69.1
fatty_acid: 14.3
NH2: 3.0
AHBA: 2.2
shikimic_acid: 0.0

PKS_AT (1224..1515): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 75.0
Methoxymalonyl-CoA: 59.5
Methylmalonyl-CoA: 55.4
inactive: 40.9
Ethylmalonyl-CoA: 34.6
fatty_acid: 34.3
Propionyl-CoA: 33.2
2-Methylbutyryl-CoA: 20.9
trans-1,2-CPDA: 18.8
CHC-CoA: 15.9
Benzoyl-CoA: 15.1
Isobutyryl-CoA: 14.0
Acetyl-CoA: 6.8
3-Methylbutyryl-CoA: 0.0

AMP-binding (2748..3153): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DflcVGIVNK
Nearest Stachelhaus code:: cap
Stachelhaus code match:: 70% (weak)

AMP-binding (3848..4258): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAqvAK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

KJCGBG_24845

Search NORINE for peptide: strict or relaxed

AMP-binding (540..927): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNvAcTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 80% (moderate)

KJCGBG_24850

Search NORINE for peptide: strict or relaxed

AMP-binding (539..941): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTyK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (1612..2006): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGmTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (2672..3070): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (3748..4140): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

KJCGBG_24855

Search NORINE for peptide: strict or relaxed

AMP-binding (539..943): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (1604..2005): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3103..3501): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (4164..4557): lys

NRPSPredictor2: lys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: ser
Single AA prediction:: lys

Stachelhaus prediction details:

Stachelhaus sequence:: DVaHhSLvEK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (5215..5604): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (6266..6648): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQfGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (7715..8098): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

KJCGBG_24860

Search NORINE for peptide: strict or relaxed

AMP-binding (489..899): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

AMP-binding (1721..2129): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSiGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 90% (moderate)

AMP-binding (2800..3192): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

KJCGBG_24905

Search NORINE for peptide: strict or relaxed

AMP-binding (26..484): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vtlSIGAVlK
Nearest Stachelhaus code:: trp
Stachelhaus code match:: 60% (weak)

contig_1 - Region 29 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 7,953,237 - 8,003,147 nt. (total: 49,911 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 44, location 7953236 - 8003147:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 45, location 7953236 - 7997350:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 46, location 7961878 - 8003147:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_25055

PKS_AT (548..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 96.6
Methoxymalonyl-CoA: 54.7
Methylmalonyl-CoA: 52.8
inactive: 49.3
Ethylmalonyl-CoA: 45.9
Propionyl-CoA: 30.3
Isobutyryl-CoA: 28.0
Benzoyl-CoA: 25.1
2-Methylbutyryl-CoA: 22.0
fatty_acid: 20.5
CHC-CoA: 16.2
3-Methylbutyryl-CoA: 15.1
trans-1,2-CPDA: 10.9
Acetyl-CoA: 0.0

KJCGBG_25070

Search NORINE for peptide: strict or relaxed

A-OX (600..1381): X

contig_1 - Region 30 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 8,035,264 - 8,185,043 nt. (total: 149,780 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 47, location 8035263 - 8185043:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (X - X - glu - pro - thr - pro) + (X) + (ccmal) + (Me-ccmal) + (mal - asn - ser - asn) + (asn - X - X - X - X) + (thr - X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 48, location 8035263 - 8063819:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 49, location 8045773 - 8106312:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (X - X - glu - pro - thr - pro) + (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 50, location 8084546 - 8185043:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - X - X) + (asn - X - X - X - X) + (mal - asn - ser - asn) + (Me-ccmal) + (ccmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_25360

PKS_AT (527..806): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.2
inactive: 74.2
Methoxymalonyl-CoA: 54.9
Methylmalonyl-CoA: 45.0
CHC-CoA: 26.2
2-Methylbutyryl-CoA: 24.9
Ethylmalonyl-CoA: 22.7
Propionyl-CoA: 20.8
Benzoyl-CoA: 16.9
trans-1,2-CPDA: 16.1
Acetyl-CoA: 14.7
Isobutyryl-CoA: 14.6
3-Methylbutyryl-CoA: 8.3
fatty_acid: 0.0

KJCGBG_25395

Search NORINE for peptide: strict or relaxed

AMP-binding (452..847): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DAgdFtqIgK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 50% (weak)

AMP-binding (1529..1920): X

NRPSPredictor2: pro, pip

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALfgGdVMK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

AMP-binding (2569..2965): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DApDIGaVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 80% (moderate)

AMP-binding (3621..4012): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQtcsqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 60% (weak)

AMP-binding (4664..5067): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5731..6128): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQtvsqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 60% (weak)

KJCGBG_25400

Search NORINE for peptide: strict or relaxed

AMP-binding (522..917): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: neTqIqn-GK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 40% (weak)

KJCGBG_25435

CAL_domain (271..699): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 20.1
NH2: 13.6
AHBA: 5.6
Acetyl-CoA: 0.3
shikimic_acid: 0.0

PKS_AT (2016..2313): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 159.5
inactive: 96.1
Methoxymalonyl-CoA: 54.3
Methylmalonyl-CoA: 41.2
Isobutyryl-CoA: 33.3
Propionyl-CoA: 32.5
fatty_acid: 19.3
Acetyl-CoA: 18.9
2-Methylbutyryl-CoA: 17.7
Benzoyl-CoA: 15.1
CHC-CoA: 12.6
Ethylmalonyl-CoA: 6.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

KJCGBG_25440

PKS_AT (571..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 122.6
inactive: 87.7
Methoxymalonyl-CoA: 57.1
Methylmalonyl-CoA: 50.4
Propionyl-CoA: 47.0
2-Methylbutyryl-CoA: 38.8
Ethylmalonyl-CoA: 35.4
Benzoyl-CoA: 25.3
CHC-CoA: 24.8
Acetyl-CoA: 23.3
fatty_acid: 17.0
trans-1,2-CPDA: 15.1
Isobutyryl-CoA: 0.8
3-Methylbutyryl-CoA: 0.0

KJCGBG_25455

Search NORINE for peptide: strict or relaxed

PKS_AT (570..855): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 154.9
inactive: 106.0
Methoxymalonyl-CoA: 69.1
Methylmalonyl-CoA: 62.8
Propionyl-CoA: 52.4
Isobutyryl-CoA: 39.8
fatty_acid: 29.6
Ethylmalonyl-CoA: 29.2
Benzoyl-CoA: 27.3
3-Methylbutyryl-CoA: 25.8
Acetyl-CoA: 21.0
2-Methylbutyryl-CoA: 20.1
CHC-CoA: 14.5
trans-1,2-CPDA: 13.6

AMP-binding (2104..2505): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DaTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (3177..3586): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (4276..4673): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DaTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

KJCGBG_25465

Search NORINE for peptide: strict or relaxed

AMP-binding (449..858): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DaTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (1519..1910): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmgmIAgVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 60% (weak)

AMP-binding (2603..3005): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDWtvSLgDK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 70% (weak)

AMP-binding (3669..4092): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRlftfrsK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 40% (weak)

AMP-binding (4948..5347): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSvLiAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

KJCGBG_25470

Search NORINE for peptide: strict or relaxed

AMP-binding (1017..1419): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2087..2486): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DahHVSeIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (3160..3555): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsIIIaGVaK
Nearest Stachelhaus code:: vol
Stachelhaus code match:: 70% (weak)

contig_1 - Region 31 - NRPS

Download region GenBank file

Download region SVG

Location: 8,919,496 - 8,965,705 nt. (total: 46,210 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 51, location 8919495 - 8965705:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_28035

Search NORINE for peptide: strict or relaxed

AMP-binding (445..837): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DlfLIGgVFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

AMP-binding (1049..1447): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVFfqGlTlK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

AMP-binding (2442..2668): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: eefLIGAVmK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

contig_1 - Region 32 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 9,037,620 - 9,130,846 nt. (total: 93,227 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 52, location 9037619 - 9130846:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal - Me-mal) + (Me-ohmal - Me-ccmal) + (mal - mal) + (ccmal) + (ccmal - Me-mal)
Non-colinear ordering:: KJCGBG_28405 + KJCGBG_28410 + KJCGBG_28420 + KJCGBG_28435 + KJCGBG_28440 + KJCGBG_28415

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_28405

PKS_AT (5..283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 110.8
inactive: 37.8
Propionyl-CoA: 33.7
Methoxymalonyl-CoA: 27.1
Methylmalonyl-CoA: 24.6
fatty_acid: 18.7
Isobutyryl-CoA: 16.4
Acetyl-CoA: 11.2
CHC-CoA: 11.0
2-Methylbutyryl-CoA: 9.0
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

contig_1 - Region 33 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 9,357,129 - 9,434,399 nt. (total: 77,271 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 53, location 9357128 - 9434399:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (thr) + (ser) + (X - D-NMe-gln) + (D-leu) + (gln - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_29230

Search NORINE for peptide: strict or relaxed

AMP-binding (470..881): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (1614..2022): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAATLgcVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 80% (moderate)

KJCGBG_29235

Search NORINE for peptide: strict or relaxed

AMP-binding (471..874): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

KJCGBG_29240

Search NORINE for peptide: strict or relaxed

AMP-binding (534..954): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmeIqGGiCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (1613..2020): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

KJCGBG_29245

Search NORINE for peptide: strict or relaxed

AMP-binding (531..932): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVgHISLIyK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

KJCGBG_29255

Search NORINE for peptide: strict or relaxed

PKS_AT (539..835): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 167.5
inactive: 109.1
Methoxymalonyl-CoA: 71.5
Methylmalonyl-CoA: 63.1
Propionyl-CoA: 41.5
Ethylmalonyl-CoA: 36.9
2-Methylbutyryl-CoA: 24.6
CHC-CoA: 24.1
Benzoyl-CoA: 22.4
Isobutyryl-CoA: 21.9
trans-1,2-CPDA: 11.3
fatty_acid: 11.1
Acetyl-CoA: 10.9
3-Methylbutyryl-CoA: 0.0

AMP-binding (1401..1811): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMIHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

KJCGBG_29260

Search NORINE for peptide: strict or relaxed

AMP-binding (468..872): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVpHFSLIEK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

contig_1 - Region 34 - NRPS

Download region GenBank file

Download region SVG

Location: 9,490,740 - 9,535,765 nt. (total: 45,026 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 54, location 9490739 - 9535765:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_29540

Search NORINE for peptide: strict or relaxed

AMP-binding (402..714): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1369..1765): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQaIsqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

contig_1 - Region 35 - RiPP-like

Download region GenBank file

Download region SVG

Location: 9,583,122 - 9,592,377 nt. (total: 9,256 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

contig_1 - Region 36 - NRPS,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 9,616,365 - 9,755,230 nt. (total: 138,866 nt) Show pHMM detection rules used

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 56, location 9616364 - 9755230:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (OMe-mal - mal - Me-ohmal - Me-ccmal - ohmal - mal) + (ohmal) + (mal) + (mal - mal - mal - thr - mal) + (gly - ccmal - ccmal - mal) + (ccmal - mal - Me-mal - mal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_29875

Search NORINE for peptide: strict or relaxed

AMP-binding (4811..5213): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

KJCGBG_29880

Search NORINE for peptide: strict or relaxed

AMP-binding (615..1014): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

KJCGBG_29885

Search NORINE for peptide: strict or relaxed

AMP-binding (6649..7072): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DieDiGAItK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

contig_1 - Region 37 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 9,862,096 - 9,927,177 nt. (total: 65,082 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 57, location 9862095 - 9927177:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - ohmal) + (val - X - ohmal) + (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_30340

Search NORINE for peptide: strict or relaxed

AMP-binding (1191..1600): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

KJCGBG_30345

Search NORINE for peptide: strict or relaxed

AMP-binding (510..914): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAYFkGaTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1574..1975): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeEIGvVtK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

PKS_AT (2706..2999): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 155.8
inactive: 88.2
Methoxymalonyl-CoA: 61.7
Methylmalonyl-CoA: 45.7
Propionyl-CoA: 33.2
2-Methylbutyryl-CoA: 21.2
Ethylmalonyl-CoA: 21.0
Acetyl-CoA: 15.9
trans-1,2-CPDA: 15.5
Benzoyl-CoA: 14.2
Isobutyryl-CoA: 13.2
CHC-CoA: 11.6
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

KJCGBG_30350

Search NORINE for peptide: strict or relaxed

AMP-binding (470..870): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFfIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

PKS_AT (2110..2403): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 139.8
inactive: 86.1
Methoxymalonyl-CoA: 66.5
Methylmalonyl-CoA: 55.6
Ethylmalonyl-CoA: 26.1
Isobutyryl-CoA: 23.7
Propionyl-CoA: 21.7
Benzoyl-CoA: 21.6
Acetyl-CoA: 19.6
2-Methylbutyryl-CoA: 16.2
CHC-CoA: 11.5
fatty_acid: 10.9
trans-1,2-CPDA: 9.6
3-Methylbutyryl-CoA: 0.0

contig_1 - Region 38 - RiPP-like

Download region GenBank file

Download region SVG

Location: 10,013,793 - 10,026,252 nt. (total: 12,460 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

contig_1 - Region 39 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 10,039,951 - 10,207,935 nt. (total: 167,985 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 59, location 10039950 - 10207935:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - X) + (asn) + (X) + (ohmal) + (X - cys) + (ser - asn - D-ile - X - asn) + (Me-redmal) + (gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 60, location 10039950 - 10083404:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 61, location 10077992 - 10106803:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal) + (ser - asn - D-ile - X - asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 62, location 10087230 - 10169827:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (X) + (ohmal) + (X - cys) + (ser - asn - D-ile - X - asn) + (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 63, location 10162327 - 10207935:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_30775

Search NORINE for peptide: strict or relaxed

CAL_domain (166..485): pk

minowa: NH2

Prediction, score:

NH2: 82.4
Acetyl-CoA: 26.4
AHBA: 21.1
shikimic_acid: 11.5
fatty_acid: 0.0

AMP-binding (1165..1606): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DIfQvGaVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

KJCGBG_30865

PKS_AT (541..835): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 75.0%; Malonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 142.6
Ethylmalonyl-CoA: 109.4
Methoxymalonyl-CoA: 107.6
Malonyl-CoA: 94.5
Propionyl-CoA: 77.7
Isobutyryl-CoA: 71.1
Acetyl-CoA: 61.2
2-Methylbutyryl-CoA: 61.2
Benzoyl-CoA: 58.5
trans-1,2-CPDA: 57.1
3-Methylbutyryl-CoA: 50.2
fatty_acid: 47.8
inactive: 38.8
CHC-CoA: 35.1

KJCGBG_30875

Search NORINE for peptide: strict or relaxed

AMP-binding (503..898): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2150..2548): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3230..3626): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGmTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (4743..5137): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGviyK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

AMP-binding (5791..6192): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

KJCGBG_30885

Search NORINE for peptide: strict or relaxed

AMP-binding (509..911): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpWQcGLIwK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

AMP-binding (1575..1971): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

KJCGBG_30890

PKS_AT (534..814): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 140.1
inactive: 73.8
Methoxymalonyl-CoA: 59.3
Methylmalonyl-CoA: 37.5
Propionyl-CoA: 20.2
fatty_acid: 16.5
Isobutyryl-CoA: 12.8
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

KJCGBG_30895

Search NORINE for peptide: strict or relaxed

AMP-binding (503..907): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpiQiGcItK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 50% (weak)

KJCGBG_30900

Search NORINE for peptide: strict or relaxed

AMP-binding (498..900): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

KJCGBG_30925

Search NORINE for peptide: strict or relaxed

AMP-binding (6..386): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: htyfIGgVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 50% (weak)

KJCGBG_31015

Search NORINE for peptide: strict or relaxed

AMP-binding (404..711): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAwLIGAViK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1367..1752): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiAVnGsVtK
Nearest Stachelhaus code:: trp
Stachelhaus code match:: 60% (weak)

contig_1 - Region 40 - NRPS

Download region GenBank file

Download region SVG

Location: 10,450,475 - 10,506,458 nt. (total: 55,984 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 64, location 10450474 - 10506458:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X - pro - phe - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_31945

Search NORINE for peptide: strict or relaxed

AMP-binding (465..869): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAhndGyVEK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

AMP-binding (1522..1926): X

NRPSPredictor2: glu, gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAhgIGaVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

AMP-binding (2581..2980): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDtGtVEK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 80% (moderate)

AMP-binding (3641..4036): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQtIsqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

AMP-binding (4692..5083): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAyvIAAVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

AMP-binding (5743..6151): X

NRPSPredictor2: tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvSTasAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

contig_1 - Region 41 - NAGGN

Download region GenBank file

Download region SVG

Location: 10,715,539 - 10,730,363 nt. (total: 14,825 nt) Show pHMM detection rules used

NAGGN: ((TIGR03104 or cds(GATase_7 and Asn_synthase)) and TIGR03103 and (TIGR03106 or Peptidase_M42))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

contig_1 - Region 42 - NRPS

Download region GenBank file

Download region SVG

Location: 10,848,844 - 10,892,932 nt. (total: 44,089 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 66, location 10848843 - 10892932:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

KJCGBG_33245

Search NORINE for peptide: strict or relaxed

AMP-binding (463..871): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenIGaImK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

contig_1 - Region 43 - arylpolyene

Download region GenBank file

Download region SVG

Location: 10,920,568 - 10,964,437 nt. (total: 43,870 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it