DHAR22-1_SAMN20209033_MAG_00000083 - 24 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	T3PKS	180,381	221,436
Region 1.2	RRE-containing	885,660	905,968

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_2

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	betalactone	17,260	40,314
Region 2.2	NRPS,T1PKS	321,535	386,472

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_3

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	RRE-containing	274,141	295,358
Region 3.2	NRPS,T1PKS	382,586	423,876

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS,T1PKS	44,151	118,748
Region 5.2	NRPS,T1PKS,terpene	165,598	355,946

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_7

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	NRPS	188,523	283,661

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_8

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	NRPS-like	63,855	107,340

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_13

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	ladderane	34,905	76,125

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_15

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	NRPS	75,775	128,598

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_17

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	NRPS,T1PKS,NRPS-like	71,470	131,454

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_19

Region	Type	From	To	Most similar known cluster		Similarity
Region 19.1	lanthipeptide-class-v	20,077	62,090

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_20

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	NRPS	1	41,818

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_26

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	lanthipeptide-class-iv	41,133	63,493

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_37

Region	Type	From	To	Most similar known cluster		Similarity
Region 37.1	NRPS	36,689	76,500

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_40

Region	Type	From	To	Most similar known cluster		Similarity
Region 40.1	NRPS,RiPP-like	1	29,864

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_41

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	lanthipeptide-class-ii,proteusin	1	22,269

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_42

Region	Type	From	To	Most similar known cluster		Similarity
Region 42.1	T3PKS	16,365	57,462

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_45

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	NRPS	1	29,778

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_53

Region	Type	From	To	Most similar known cluster		Similarity
Region 53.1	NRPS,T1PKS	1	38,821

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_62

Region	Type	From	To	Most similar known cluster		Similarity
Region 62.1	NRPS	1	19,369

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_63

Region	Type	From	To	Most similar known cluster		Similarity
Region 63.1	NRPS	1	17,524

Region	Type	From	To	Similarity
Region 1.1	T3PKS	180,381	221,436
Region 1.2	RRE-containing	885,660	905,968
Region 2.1	betalactone	17,260	40,314
Region 2.2	NRPS,T1PKS	321,535	386,472
Region 3.1	RRE-containing	274,141	295,358
Region 3.2	NRPS,T1PKS	382,586	423,876
Region 5.1	NRPS,T1PKS	44,151	118,748
Region 5.2	NRPS,T1PKS,terpene	165,598	355,946
Region 7.1	NRPS	188,523	283,661
Region 8.1	NRPS-like	63,855	107,340
Region 13.1	ladderane	34,905	76,125
Region 15.1	NRPS	75,775	128,598
Region 17.1	NRPS,T1PKS,NRPS-like	71,470	131,454
Region 19.1	lanthipeptide-class-v	20,077	62,090
Region 20.1	NRPS	1	41,818
Region 26.1	lanthipeptide-class-iv	41,133	63,493
Region 37.1	NRPS	36,689	76,500
Region 40.1	NRPS,RiPP-like	1	29,864
Region 41.1	lanthipeptide-class-ii,proteusin	1	22,269
Region 42.1	T3PKS	16,365	57,462
Region 45.1	NRPS	1	29,778
Region 53.1	NRPS,T1PKS	1	38,821
Region 62.1	NRPS	1	19,369
Region 63.1	NRPS	1	17,524

No secondary metabolite regions were found in these records:: DHAR22-1_SAMN20209033_MAG_00000083-scaffold_4; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_6; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_9; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_10; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_11; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_12; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_14; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_16; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_18; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_21; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_22; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_23; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_24; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_25; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_27; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_28; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_29; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_30; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_31; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_32; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_33; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_34; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_35; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_36; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_38; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_39; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_43; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_44; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_46; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_47; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_48; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_49; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_50; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_51; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_52; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_54; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_55; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_56; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_57; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_58; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_59; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_60; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_61; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_64; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_65; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_66; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_67; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_68; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_69; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_70; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_71; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_72; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_73; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_74; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_75; DHAR22-1_SAMN20209033_MAG_00000083-scaffold_76

Compact view

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 180,381 - 221,436 nt. (total: 41,056 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_1 - Region 2 - RRE-containing

Download region GenBank file

Download region SVG

Location: 885,660 - 905,968 nt. (total: 20,309 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_2 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 17,260 - 40,314 nt. (total: 23,055 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_2 - Region 2 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 321,535 - 386,472 nt. (total: 64,938 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 321534 - 386472:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ile) + (ohmal) + (D-X) + (D-X - pip)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_2_282

Search NORINE for peptide: strict or relaxed

CAL_domain (34..481): pk

minowa: NH2

Prediction, score:

NH2: 212.0
fatty_acid: 23.0
AHBA: 13.8
shikimic_acid: 0.0
Acetyl-CoA: -3.2

AMP-binding (1156..1546): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_2_283

PKS_AT (549..840): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%; Propionyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 97.1
Methoxymalonyl-CoA: 63.0
Methylmalonyl-CoA: 48.3
Propionyl-CoA: 45.9
inactive: 33.8
2-Methylbutyryl-CoA: 28.1
fatty_acid: 26.8
CHC-CoA: 22.3
3-Methylbutyryl-CoA: 19.1
Ethylmalonyl-CoA: 17.9
Isobutyryl-CoA: 17.2
Acetyl-CoA: 16.1
trans-1,2-CPDA: 16.0
Benzoyl-CoA: 14.7

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_2_285

Search NORINE for peptide: strict or relaxed

AMP-binding (510..939): X

NRPSPredictor2: ile, val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWLGCTFK
Nearest Stachelhaus code:: val, ile
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_2_286

Search NORINE for peptide: strict or relaxed

AMP-binding (493..919): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DveNVGaVtK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 60% (weak)

AMP-binding (2086..2505): pip

NRPSPredictor2: pip

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: pip

Stachelhaus prediction details:

Stachelhaus sequence:: DpLliGLItK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 60% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_3 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 274,141 - 295,358 nt. (total: 21,218 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_3 - Region 2 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 382,586 - 423,876 nt. (total: 41,291 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 382585 - 423876:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - leu - cys - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_3_305

Search NORINE for peptide: strict or relaxed

AMP-binding (27..418): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFlVAAVaK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

AMP-binding (1096..1522): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2191..2616): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLydFSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

PKS_AT (3359..3654): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 143.2
inactive: 90.3
Methoxymalonyl-CoA: 52.8
Methylmalonyl-CoA: 47.6
Propionyl-CoA: 44.1
2-Methylbutyryl-CoA: 31.5
Ethylmalonyl-CoA: 22.3
CHC-CoA: 21.9
Benzoyl-CoA: 14.9
3-Methylbutyryl-CoA: 10.0
trans-1,2-CPDA: 9.7
fatty_acid: 9.4
Isobutyryl-CoA: 9.4
Acetyl-CoA: 0.0

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 44,151 - 118,748 nt. (total: 74,598 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 44150 - 118748:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ile - X - asp) + (val - X) + (mal) + (D-X) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_52

Search NORINE for peptide: strict or relaxed

AMP-binding (532..946): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGgTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (1668..2081): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpLnvGAVeK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (2790..3209): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKaGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_53

Search NORINE for peptide: strict or relaxed

AMP-binding (508..912): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1603..1994): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsFTVAAVwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_54

PKS_AT (531..820): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 149.7
inactive: 83.2
Methoxymalonyl-CoA: 78.0
Methylmalonyl-CoA: 76.1
Propionyl-CoA: 50.8
Ethylmalonyl-CoA: 45.7
2-Methylbutyryl-CoA: 43.5
CHC-CoA: 32.9
Isobutyryl-CoA: 28.8
Benzoyl-CoA: 26.7
Acetyl-CoA: 26.7
fatty_acid: 23.7
trans-1,2-CPDA: 13.1
3-Methylbutyryl-CoA: 9.3

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_55

Search NORINE for peptide: strict or relaxed

AMP-binding (1245..1667): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeMtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_56

Search NORINE for peptide: strict or relaxed

AMP-binding (490..946): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeLtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_57

Search NORINE for peptide: strict or relaxed

AMP-binding (970..1391): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeLtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5 - Region 2 - NRPS,T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 165,598 - 355,946 nt. (total: 190,349 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 165597 - 355946:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr - ohmal) + (mal - val - X) + (gly - orn - pro - X - X - X - X - pro - ala) + (ser) + (D-ser - X) + (Me-ccmal) + (leu - ohmal) + (X - ser - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 165597 - 255417:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr - ohmal) + (mal - val - X) + (gly - orn - pro - X - X - X - X - pro - ala)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 264863 - 355946:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (D-ser - X) + (Me-ccmal) + (leu - ohmal) + (X - ser - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_103

Search NORINE for peptide: strict or relaxed

CAL_domain (49..519): pk

minowa: NH2

Prediction, score:

NH2: 172.0
AHBA: 8.0
Acetyl-CoA: 4.7
shikimic_acid: 0.0
fatty_acid: -2.6

AMP-binding (1314..1791): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

PKS_AT (2522..2834): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.9
Methoxymalonyl-CoA: 72.9
inactive: 69.5
Methylmalonyl-CoA: 59.1
Propionyl-CoA: 45.2
Isobutyryl-CoA: 32.4
Acetyl-CoA: 22.4
2-Methylbutyryl-CoA: 20.4
Ethylmalonyl-CoA: 18.7
3-Methylbutyryl-CoA: 18.0
CHC-CoA: 14.7
fatty_acid: 13.0
Benzoyl-CoA: 11.5
trans-1,2-CPDA: 9.0

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_104

Search NORINE for peptide: strict or relaxed

PKS_AT (546..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.1
Methoxymalonyl-CoA: 66.4
inactive: 65.9
Methylmalonyl-CoA: 54.6
Propionyl-CoA: 40.2
2-Methylbutyryl-CoA: 26.7
CHC-CoA: 25.7
Ethylmalonyl-CoA: 24.9
trans-1,2-CPDA: 16.7
Benzoyl-CoA: 16.5
Acetyl-CoA: 16.0
Isobutyryl-CoA: 15.5
fatty_acid: 14.4
3-Methylbutyryl-CoA: 0.0

AMP-binding (1504..1917): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALfLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (2573..2973): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVliaSrIaK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_105

Search NORINE for peptide: strict or relaxed

AMP-binding (471..869): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1567..1985): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

AMP-binding (2680..3096): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQYIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (3787..4196): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAwlLGVVmK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

AMP-binding (4855..5257): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVqqVGAItK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (5933..6335): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVqqVGAItK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (7001..7430): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWlvGaVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

AMP-binding (8107..8534): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DiQYvAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (9225..9631): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLwNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_136

Search NORINE for peptide: strict or relaxed

CAL_domain (189..505): pk

minowa: NH2

Prediction, score:

NH2: 91.5
fatty_acid: 29.0
Acetyl-CoA: 25.7
shikimic_acid: 10.6
AHBA: 0.0

AMP-binding (1339..1774): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2534..2945): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_138

Search NORINE for peptide: strict or relaxed

AMP-binding (547..948): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2125..2598): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAeDIGtVaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_139

CAL_domain (41..483): pk

minowa: NH2

Prediction, score:

NH2: 17.6
fatty_acid: 12.7
AHBA: 11.2
Acetyl-CoA: 0.3
shikimic_acid: 0.0

PKS_AT (1308..1613): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Malonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 130.5
Ethylmalonyl-CoA: 121.3
Methoxymalonyl-CoA: 98.9
Isobutyryl-CoA: 91.9
Malonyl-CoA: 91.8
Propionyl-CoA: 75.6
Benzoyl-CoA: 72.7
trans-1,2-CPDA: 65.5
Acetyl-CoA: 59.2
3-Methylbutyryl-CoA: 47.3
2-Methylbutyryl-CoA: 41.4
fatty_acid: 39.0
CHC-CoA: 38.5
inactive: 12.9

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_140

Search NORINE for peptide: strict or relaxed

AMP-binding (529..958): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

PKS_AT (1732..2044): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 166.1
inactive: 115.0
Methoxymalonyl-CoA: 72.5
Methylmalonyl-CoA: 68.0
Propionyl-CoA: 50.8
Ethylmalonyl-CoA: 41.5
Isobutyryl-CoA: 39.7
2-Methylbutyryl-CoA: 34.6
CHC-CoA: 34.4
Benzoyl-CoA: 31.7
fatty_acid: 23.3
Acetyl-CoA: 23.3
trans-1,2-CPDA: 18.6
3-Methylbutyryl-CoA: 13.9

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_5_141

Search NORINE for peptide: strict or relaxed

AMP-binding (546..1007): X

NRPSPredictor2: glu, gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEnVGavtK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 60% (weak)

AMP-binding (1701..2145): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

PKS_AT (2907..3195): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 155.2
inactive: 84.7
Methoxymalonyl-CoA: 71.2
Methylmalonyl-CoA: 60.0
Propionyl-CoA: 47.2
2-Methylbutyryl-CoA: 30.5
Ethylmalonyl-CoA: 27.8
Isobutyryl-CoA: 26.2
CHC-CoA: 20.9
Benzoyl-CoA: 20.4
Acetyl-CoA: 17.2
trans-1,2-CPDA: 16.2
fatty_acid: 16.1
3-Methylbutyryl-CoA: 11.8

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_7 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 188,523 - 283,661 nt. (total: 95,139 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 188522 - 283661:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - X - X - D-X - D-val) + (D-X - D-X - D-X - D-X - D-X - D-X - D-X) + (tyr - ile - val - val - ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_7_177

Search NORINE for peptide: strict or relaxed

AMP-binding (511..927): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1617..2027): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (2699..3109): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAlhLGCTFK
Nearest Stachelhaus code:: val, ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (3781..4189): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (4932..5347): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLwNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (6036..6448): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVfTtGAstK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_7_178

Search NORINE for peptide: strict or relaxed

AMP-binding (501..919): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeElGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (2077..2507): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeElGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (3674..4105): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeElGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (5259..5666): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeElGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (6832..7262): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeElGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (8435..8860): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeElGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (10115..10566): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_7_179

Search NORINE for peptide: strict or relaxed

AMP-binding (282..706): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1765..2175): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLLiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 80% (moderate)

AMP-binding (2892..3332): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHyGLLiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 80% (moderate)

AMP-binding (4040..4464): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (5627..6036): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_8 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 63,855 - 107,340 nt. (total: 43,486 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 63854 - 107340:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_8_40

Search NORINE for peptide: strict or relaxed

AMP-binding (531..965): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: eqvvaGGPvK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 40% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_13 - Region 1 - ladderane

Download region GenBank file

Download region SVG

Location: 34,905 - 76,125 nt. (total: 41,221 nt) Show pHMM detection rules used

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_15 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 75,775 - 128,598 nt. (total: 52,824 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 75774 - 128598:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_15_70

Search NORINE for peptide: strict or relaxed

AMP-binding (9..475): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: a-FYLavvCK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_15_72

Search NORINE for peptide: strict or relaxed

AMP-binding (545..992): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_15_77

Search NORINE for peptide: strict or relaxed

AMP-binding (548..944): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSaLiAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_17 - Region 1 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 71,470 - 131,454 nt. (total: 59,985 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 71469 - 131454:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (Me-ccmal) + (gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 71469 - 115807:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (Me-ccmal) + (gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 77645 - 129465:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (Me-ccmal) + (gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 89474 - 131454:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (Me-ccmal) + (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_17_67

Search NORINE for peptide: strict or relaxed

AMP-binding (549..946): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_17_69

PKS_AT (586..883): mmal

ATSignature: Methylmalonyl-CoA, Malonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 66.7%; Malonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 125.8
Ethylmalonyl-CoA: 109.0
Methoxymalonyl-CoA: 104.7
Isobutyryl-CoA: 94.9
Malonyl-CoA: 83.3
Benzoyl-CoA: 66.2
Propionyl-CoA: 65.8
2-Methylbutyryl-CoA: 59.0
trans-1,2-CPDA: 56.3
Acetyl-CoA: 48.5
CHC-CoA: 38.7
fatty_acid: 38.6
3-Methylbutyryl-CoA: 38.6
inactive: 29.7

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_17_70

PKS_AT (562..885): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.0
Methoxymalonyl-CoA: 49.5
inactive: 49.2
Methylmalonyl-CoA: 46.4
Propionyl-CoA: 34.5
Isobutyryl-CoA: 25.5
2-Methylbutyryl-CoA: 25.0
CHC-CoA: 24.5
Acetyl-CoA: 17.9
Ethylmalonyl-CoA: 14.2
3-Methylbutyryl-CoA: 14.1
Benzoyl-CoA: 13.7
trans-1,2-CPDA: 13.6
fatty_acid: 0.0

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_17_71

Search NORINE for peptide: strict or relaxed

AMP-binding (12..405): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gqaFfAGpFK
Nearest Stachelhaus code:: iva
Stachelhaus code match:: 50% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_19 - Region 1 - lanthipeptide-class-v

Download region GenBank file

Download region SVG

Location: 20,077 - 62,090 nt. (total: 42,014 nt) Show pHMM detection rules used

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_20 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 41,818 nt. (total: 41,818 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 41818:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - cys - NMe-cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_20_10

Search NORINE for peptide: strict or relaxed

CAL_domain (57..504): pk

minowa: NH2

Prediction, score:

NH2: 164.2
Acetyl-CoA: 47.1
fatty_acid: 13.7
AHBA: 4.0
shikimic_acid: 0.0

AMP-binding (1163..1612): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRnfvfqGK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

AMP-binding (2294..2695): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

AMP-binding (3391..3821): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLydFSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_26 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 41,133 - 63,493 nt. (total: 22,361 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_37 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 36,689 - 76,500 nt. (total: 39,812 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 36688 - 76500:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro - pro - pro - ala - X - tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_37_41

Search NORINE for peptide: strict or relaxed

AMP-binding (15..306): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQYyAqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (1054..1501): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQYyAqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (2276..2666): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQhyAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (3373..3769): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (4467..4861): X

NRPSPredictor2: asp, asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKnLsVanK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (5618..6039): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_40 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 29,864 nt. (total: 29,864 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 29864:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_40_1

Search NORINE for peptide: strict or relaxed

AMP-binding (394..788): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DVydLAAVYK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_40_3

Search NORINE for peptide: strict or relaxed

AMP-binding (434..834): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_41 - Region 1 - lanthipeptide-class-ii,proteusin

Download region GenBank file

Download region SVG

Location: 1 - 22,269 nt. (total: 22,269 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
proteusin: (PoyD or TIGR03793)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for DHAR22-1_SAMN20209033_MAG_00000083-scaffold_41_12 - Putative Class II

allorf_12339_12521 leader / core peptide: VLRRVSSPFSRGYLRFVLPEPFSREKEPSGGG - KPPDhaDhaWVQGDhaRFMFDhaVCGLDGCGLFDhaRF

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_12339_12521 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 3004.5 Da

Molecular weight: 3006.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3024.5 Da N = 1; 3042.5 Da N = 2; 3060.5 Da N = 3

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_42 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 16,365 - 57,462 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_45 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 29,778 nt. (total: 29,778 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 29778:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_45_1

Search NORINE for peptide: strict or relaxed

CAL_domain (187..510): pk

minowa: NH2

Prediction, score:

NH2: 173.9
Acetyl-CoA: 38.8
fatty_acid: 18.1
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1159..1559): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2551..2953): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_53 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 38,821 nt. (total: 38,821 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 38821:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (ser - D-val) + (D-X - asp) + (val - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_53_8

Search NORINE for peptide: strict or relaxed

AMP-binding (491..885): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALfLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (1558..1959): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_53_9

Search NORINE for peptide: strict or relaxed

AMP-binding (495..904): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: nveeLGVVtK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 50% (weak)

AMP-binding (2036..2438): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DsTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_53_12

Search NORINE for peptide: strict or relaxed

AMP-binding (503..927): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1613..2016): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWfGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_53_13

PKS_AT (471..767): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 141.1
Methoxymalonyl-CoA: 77.9
inactive: 76.7
Methylmalonyl-CoA: 65.5
Propionyl-CoA: 56.8
2-Methylbutyryl-CoA: 44.4
Ethylmalonyl-CoA: 37.7
Isobutyryl-CoA: 27.3
CHC-CoA: 27.3
fatty_acid: 26.2
Acetyl-CoA: 19.8
3-Methylbutyryl-CoA: 18.9
Benzoyl-CoA: 14.5
trans-1,2-CPDA: 13.0

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_62 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 19,369 nt. (total: 19,369 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 19369:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - glu - X - ser - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_62_1

Search NORINE for peptide: strict or relaxed

AMP-binding (470..867): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAnSsGlVwK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

AMP-binding (1526..1937): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DgKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 90% (moderate)

AMP-binding (2598..2998): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGgTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (3659..4055): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (4725..5125): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAiVsGlVwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_63 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 17,524 nt. (total: 17,524 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 17524:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

DHAR22-1_SAMN20209033_MAG_00000083-scaffold_63_16

Search NORINE for peptide: strict or relaxed

AMP-binding (495..890): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAaTnAlIwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)