A.PEDIS-GCF_017377855.1_ASM1737785v1_genomic - 40 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAFREP010000011.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	NRPS,T1PKS	35,821	133,115

NZ_JAFREP010000012.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	NRPS	1	69,677

NZ_JAFREP010000013.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	NRPS-like,T1PKS	59,435	110,040
Region 3.2	NRPS,T1PKS,thiopeptide	287,572	357,014

NZ_JAFREP010000016.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	transAT-PKS-like	43,556	94,622
Region 6.2	linaridin,RRE-containing	179,264	200,814

NZ_JAFREP010000018.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	arylpolyene	142,667	186,624

NZ_JAFREP010000019.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	NRPS-like,NRPS	4,220	68,267

NZ_JAFREP010000026.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	NRPS,T1PKS	43,714	122,599

NZ_JAFREP010000028.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 19.1	T1PKS	107,961	153,372

NZ_JAFREP010000030.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	transAT-PKS,NRPS	37,909	135,990

NZ_JAFREP010000002.1

Region	Type	From	To
Region 23.1	NRPS-like,NRPS,T1PKS	190,953	284,072
Region 23.2	NRPS	377,304	420,302
Region 23.3	NRPS	452,868	532,278

NZ_JAFREP010000035.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 27.1	T1PKS,NRPS	7,355	63,268

NZ_JAFREP010000038.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	NRPS	55,075	96,430

NZ_JAFREP010000042.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	NRPS	1	43,769

NZ_JAFREP010000003.1

Region	Type	From	To
Region 34.1	T3PKS	34,401	75,441
Region 34.2	thiopeptide,thioamitides	138,175	168,369
Region 34.3	NRPS	287,391	344,045
Region 34.4	transAT-PKS,NRPS,NRPS-like	395,107	511,099

NZ_JAFREP010000043.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	hglE-KS,T1PKS	2,500	54,071

NZ_JAFREP010000045.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 37.1	RiPP-like	11,080	21,524
Region 37.2	RiPP-like	55,395	66,339

NZ_JAFREP010000047.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	NRPS-like,NRPS	1	54,589

NZ_JAFREP010000049.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	terpene	19,217	41,097

NZ_JAFREP010000050.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 42.1	NRPS,T1PKS	7,071	52,542

NZ_JAFREP010000004.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	NRPS	126,642	189,488
Region 45.2	T1PKS	357,810	402,324

NZ_JAFREP010000005.1

Region	Type	From	To
Region 58.1	NRPS-like	1	31,103
Region 58.2	lassopeptide,RRE-containing	64,292	87,941
Region 58.3	RRE-containing	91,542	111,838

NZ_JAFREP010000006.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 69.1	T1PKS,NRPS-like	718	62,324
Region 69.2	NRPS-like,NRPS,T1PKS	305,831	399,982

NZ_JAFREP010000007.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 73.1	NRPS,T1PKS	65,542	124,982
Region 73.2	arylpolyene	302,781	344,007

NZ_JAFREP010000008.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 74.1	hglE-KS	104,802	159,892

NZ_JAFREP010000010.1

Region	Type	From	To
Region 76.1	T3PKS,transAT-PKS,PKS-like,NRPS-like,NRPS	20,410	117,463
Region 76.2	NRPS	140,623	198,102
Region 76.3	NRPS	207,857	251,795

Region	Type	From	To	Similarity
Region 1.1	NRPS,T1PKS	35,821	133,115
Region 2.1	NRPS	1	69,677
Region 3.1	NRPS-like,T1PKS	59,435	110,040
Region 3.2	NRPS,T1PKS,thiopeptide	287,572	357,014
Region 6.1	transAT-PKS-like	43,556	94,622
Region 6.2	linaridin,RRE-containing	179,264	200,814
Region 8.1	arylpolyene	142,667	186,624
Region 9.1	NRPS-like,NRPS	4,220	68,267
Region 17.1	NRPS,T1PKS	43,714	122,599
Region 19.1	T1PKS	107,961	153,372
Region 21.1	transAT-PKS,NRPS	37,909	135,990
Region 23.1	NRPS-like,NRPS,T1PKS	190,953	284,072
Region 23.2	NRPS	377,304	420,302
Region 23.3	NRPS	452,868	532,278
Region 27.1	T1PKS,NRPS	7,355	63,268
Region 29.1	NRPS	55,075	96,430
Region 33.1	NRPS	1	43,769
Region 34.1	T3PKS	34,401	75,441
Region 34.2	thiopeptide,thioamitides	138,175	168,369
Region 34.3	NRPS	287,391	344,045
Region 34.4	transAT-PKS,NRPS,NRPS-like	395,107	511,099
Region 35.1	hglE-KS,T1PKS	2,500	54,071
Region 37.1	RiPP-like	11,080	21,524
Region 37.2	RiPP-like	55,395	66,339
Region 39.1	NRPS-like,NRPS	1	54,589
Region 41.1	terpene	19,217	41,097
Region 42.1	NRPS,T1PKS	7,071	52,542
Region 45.1	NRPS	126,642	189,488
Region 45.2	T1PKS	357,810	402,324
Region 58.1	NRPS-like	1	31,103
Region 58.2	lassopeptide,RRE-containing	64,292	87,941
Region 58.3	RRE-containing	91,542	111,838
Region 69.1	T1PKS,NRPS-like	718	62,324
Region 69.2	NRPS-like,NRPS,T1PKS	305,831	399,982
Region 73.1	NRPS,T1PKS	65,542	124,982
Region 73.2	arylpolyene	302,781	344,007
Region 74.1	hglE-KS	104,802	159,892
Region 76.1	T3PKS,transAT-PKS,PKS-like,NRPS-like,NRPS	20,410	117,463
Region 76.2	NRPS	140,623	198,102
Region 76.3	NRPS	207,857	251,795

No secondary metabolite regions were found in these records:: NZ_JAFREP010000014.1; NZ_JAFREP010000015.1; NZ_JAFREP010000017.1; NZ_JAFREP010000020.1; NZ_JAFREP010000021.1; NZ_JAFREP010000001.1; NZ_JAFREP010000022.1; NZ_JAFREP010000023.1; NZ_JAFREP010000024.1; NZ_JAFREP010000025.1; NZ_JAFREP010000027.1; NZ_JAFREP010000029.1; NZ_JAFREP010000031.1; NZ_JAFREP010000032.1; NZ_JAFREP010000033.1; NZ_JAFREP010000034.1; NZ_JAFREP010000037.1; NZ_JAFREP010000039.1; NZ_JAFREP010000040.1; NZ_JAFREP010000041.1; NZ_JAFREP010000044.1; NZ_JAFREP010000046.1; NZ_JAFREP010000048.1; NZ_JAFREP010000051.1; NZ_JAFREP010000052.1; NZ_JAFREP010000053.1; NZ_JAFREP010000054.1; NZ_JAFREP010000055.1; NZ_JAFREP010000056.1; NZ_JAFREP010000057.1; NZ_JAFREP010000058.1; NZ_JAFREP010000059.1; NZ_JAFREP010000060.1; NZ_JAFREP010000061.1; NZ_JAFREP010000062.1; NZ_JAFREP010000063.1; NZ_JAFREP010000064.1; NZ_JAFREP010000065.1; NZ_JAFREP010000066.1; NZ_JAFREP010000067.1; NZ_JAFREP010000068.1; NZ_JAFREP010000069.1; NZ_JAFREP010000070.1; NZ_JAFREP010000071.1; NZ_JAFREP010000072.1; NZ_JAFREP010000073.1; NZ_JAFREP010000074.1; NZ_JAFREP010000075.1; NZ_JAFREP010000076.1; NZ_JAFREP010000077.1; NZ_JAFREP010000009.1

Compact view

NZ_JAFREP010000011.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 35,821 - 133,115 nt. (total: 97,295 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 35820 - 133115:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - arg - D-orn) + (X - D-X - pro) + (X) + (ohmal) + (gly) + (gly - ser) + (ser - X) + (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_36

Search NORINE for peptide: strict or relaxed

AMP-binding (489..894): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIalVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 80% (moderate)

ctg1_37

Search NORINE for peptide: strict or relaxed

AMP-binding (538..932): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1580..1976): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiENiGtIiK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

ctg1_38

Search NORINE for peptide: strict or relaxed

AMP-binding (512..901): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1651..2049): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg1_39

Search NORINE for peptide: strict or relaxed

AMP-binding (507..900): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DIfQqGLIyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

ctg1_40

PKS_AT (531..822): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.6
inactive: 131.3
Methoxymalonyl-CoA: 55.3
Methylmalonyl-CoA: 48.2
Propionyl-CoA: 32.6
Ethylmalonyl-CoA: 23.1
2-Methylbutyryl-CoA: 21.3
CHC-CoA: 20.4
Isobutyryl-CoA: 19.0
fatty_acid: 15.3
Benzoyl-CoA: 13.8
Acetyl-CoA: 10.2
3-Methylbutyryl-CoA: 4.6
trans-1,2-CPDA: 0.0

ctg1_41

Search NORINE for peptide: strict or relaxed

AMP-binding (433..829): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVgsIaK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

ctg1_42

Search NORINE for peptide: strict or relaxed

AMP-binding (497..890): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (1620..2020): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (3104..3500): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

ctg1_43

Search NORINE for peptide: strict or relaxed

PKS_AT (561..842): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.0
inactive: 85.1
Methoxymalonyl-CoA: 48.1
Methylmalonyl-CoA: 44.2
CHC-CoA: 29.5
Propionyl-CoA: 24.6
Ethylmalonyl-CoA: 21.9
Isobutyryl-CoA: 18.7
Benzoyl-CoA: 17.5
2-Methylbutyryl-CoA: 14.3
Acetyl-CoA: 10.8
trans-1,2-CPDA: 9.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (1998..2380): arg

NRPSPredictor2: arg

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVAqVGAItK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 80% (moderate)

AMP-binding (3027..3433): orn

NRPSPredictor2: orn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEItSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 90% (moderate)

ctg1_44

CAL_domain (43..487): pk

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 48.2
fatty_acid: 35.9
NH2: 24.0
AHBA: 6.8
shikimic_acid: 0.0

NZ_JAFREP010000012.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 69,677 nt. (total: 69,677 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 69677:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - cys - cys - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_16

Search NORINE for peptide: strict or relaxed

CAL_domain (280..699): pk

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 8.6
fatty_acid: 4.4
NH2: 0.4
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1911..2311): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNfSgIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (2977..3377): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSgvWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (4055..4454): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSMIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

AMP-binding (5129..5526): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: PgYrinylWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 40% (weak)

ctg2_27

Search NORINE for peptide: strict or relaxed

AMP-binding (261..644): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: eMiAmkVgwK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 40% (weak)

NZ_JAFREP010000013.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 59,435 - 110,040 nt. (total: 50,606 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 59434 - 110040:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 59434 - 102891:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 66071 - 110040:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg3_52

Search NORINE for peptide: strict or relaxed

A-OX (599..1379): X

ctg3_55

PKS_AT (545..843): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.0
inactive: 61.5
Methoxymalonyl-CoA: 54.4
Methylmalonyl-CoA: 51.8
Ethylmalonyl-CoA: 34.1
Benzoyl-CoA: 24.3
Propionyl-CoA: 18.3
Isobutyryl-CoA: 17.1
3-Methylbutyryl-CoA: 15.2
fatty_acid: 14.8
2-Methylbutyryl-CoA: 14.8
CHC-CoA: 8.4
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0

NZ_JAFREP010000013.1 - Region 2 - NRPS,T1PKS,thiopeptide

Download region GenBank file

Download region SVG

Location: 287,572 - 357,014 nt. (total: 69,443 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Thiopeptides

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Thiopeptide predictions

No core peptides found.

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Thiopeptides

Predicted core structure(s)

For candidate cluster 4, location 287571 - 357014:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 287571 - 334582:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg3_180

Search NORINE for peptide: strict or relaxed

PKS_AT (534..821): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 116.6
inactive: 69.5
Methoxymalonyl-CoA: 61.5
Methylmalonyl-CoA: 53.9
Propionyl-CoA: 26.9
Isobutyryl-CoA: 25.7
3-Methylbutyryl-CoA: 21.4
Ethylmalonyl-CoA: 19.9
2-Methylbutyryl-CoA: 18.9
Acetyl-CoA: 15.9
CHC-CoA: 15.8
fatty_acid: 15.6
trans-1,2-CPDA: 14.3
Benzoyl-CoA: 6.7

AMP-binding (1470..1881): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DATKVtEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

Core peptide predictions

No core peptides found.

NZ_JAFREP010000016.1 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 43,556 - 94,622 nt. (total: 51,067 nt) Show pHMM detection rules used

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NZ_JAFREP010000016.1 - Region 2 - RRE-containing,linaridin

Download region GenBank file

Download region SVG

Location: 179,264 - 200,814 nt. (total: 21,551 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NZ_JAFREP010000018.1 - Region 1 - arylpolyene

Download region GenBank file

Download region SVG

Location: 142,667 - 186,624 nt. (total: 43,958 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NZ_JAFREP010000019.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 4,220 - 68,267 nt. (total: 64,048 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 4219 - 68267:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - X - X - pro - phe - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 4219 - 27249:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 7867 - 68267:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - X - X - pro - phe - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg9_12

Search NORINE for peptide: strict or relaxed

AMP-binding (19..405): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DtmvLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

ctg9_13

Search NORINE for peptide: strict or relaxed

AMP-binding (462..874): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAhgeGyVEK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

AMP-binding (1523..1930): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAdVrGyVnK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (2586..2986): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDtGtVEK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 80% (moderate)

AMP-binding (3643..4041): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQtIsqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

AMP-binding (4696..5090): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAylIAAVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

AMP-binding (5765..6159): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvSTasAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

NZ_JAFREP010000026.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 43,714 - 122,599 nt. (total: 78,886 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 43713 - 122599:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - pro - asn) + (X - pk - Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg17_43

Search NORINE for peptide: strict or relaxed

AMP-binding (530..934): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DlesLGgVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

PKS_AT (1675..1831): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (3074..3362): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 111.2
inactive: 64.2
Methoxymalonyl-CoA: 53.3
Methylmalonyl-CoA: 52.3
Ethylmalonyl-CoA: 31.6
Propionyl-CoA: 26.5
fatty_acid: 20.3
2-Methylbutyryl-CoA: 20.3
CHC-CoA: 17.1
trans-1,2-CPDA: 11.2
3-Methylbutyryl-CoA: 10.9
Benzoyl-CoA: 9.3
Isobutyryl-CoA: 9.0
Acetyl-CoA: 0.0

ctg17_48

Search NORINE for peptide: strict or relaxed

CAL_domain (155..456): pk

minowa: NH2

Prediction, score:

NH2: 96.9
Acetyl-CoA: 44.9
fatty_acid: 9.7
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1124..1538): X

NRPSPredictor2: orn, lys, arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DaENnGgIaK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (2620..3011): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVemItfVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 60% (weak)

AMP-binding (3671..4071): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DalKVGqIaK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 60% (weak)

ctg17_59

Search NORINE for peptide: strict or relaxed

AMP-binding (79..228): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gFfi--V--K
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 30% (weak)

NZ_JAFREP010000028.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 107,961 - 153,372 nt. (total: 45,412 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 107960 - 153372:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg19_77

Search NORINE for peptide: strict or relaxed

AMP-binding (38..461): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vLGFtAnLaK
Nearest Stachelhaus code:: iva
Stachelhaus code match:: 60% (weak)

ctg19_78

PKS_AT (551..853): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 79.2%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 147.3
Ethylmalonyl-CoA: 134.3
Methoxymalonyl-CoA: 119.8
Malonyl-CoA: 104.2
Propionyl-CoA: 90.9
2-Methylbutyryl-CoA: 90.7
CHC-CoA: 69.4
Isobutyryl-CoA: 59.6
trans-1,2-CPDA: 50.8
Benzoyl-CoA: 45.2
inactive: 42.8
Acetyl-CoA: 34.3
fatty_acid: 28.2
3-Methylbutyryl-CoA: 4.3

NZ_JAFREP010000030.1 - Region 1 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 37,909 - 135,990 nt. (total: 98,082 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 37908 - 135990:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - mal - ccmal) + (ccmal - ohmal - ccmal) + (mal - mal) + (gly - ccmal - ccmal - ccmal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg21_41

Search NORINE for peptide: strict or relaxed

AMP-binding (509..905): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (7370..7779): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeqVGgVtK
Nearest Stachelhaus code:: d-lyserg
Stachelhaus code match:: 60% (weak)

ctg21_45

PKS_AT (8..270): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 103.5
inactive: 47.0
Methoxymalonyl-CoA: 20.3
Methylmalonyl-CoA: 19.7
Propionyl-CoA: 16.4
fatty_acid: 11.0
Acetyl-CoA: 8.5
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

NZ_JAFREP010000002.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 190,953 - 284,072 nt. (total: 93,120 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 190952 - 284072:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr) + (ohmal) + (mal - D-thr) + (X - thr - Me-ohmal) + (gly) + (X) + (D-ile - asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 190952 - 229423:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - thr - Me-ohmal) + (gly) + (X) + (D-ile - asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 194860 - 284072:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr) + (ohmal) + (mal - D-thr) + (X - thr - Me-ohmal) + (gly) + (X) + (D-ile - asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg23_139

Search NORINE for peptide: strict or relaxed

AMP-binding (423..710): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg23_141

Search NORINE for peptide: strict or relaxed

AMP-binding (499..893): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAlFmGVTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1998..2384): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLsKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg23_142

Search NORINE for peptide: strict or relaxed

AMP-binding (501..857): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: sALaLqaLvK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 50% (weak)

ctg23_143

Search NORINE for peptide: strict or relaxed

AMP-binding (528..932): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg23_144

Search NORINE for peptide: strict or relaxed

AMP-binding (1007..1401): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfGsqiK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (2049..2453): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

PKS_AT (3169..3447): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.6
inactive: 75.6
Methoxymalonyl-CoA: 64.4
Methylmalonyl-CoA: 44.7
Propionyl-CoA: 40.9
2-Methylbutyryl-CoA: 24.3
CHC-CoA: 21.9
Ethylmalonyl-CoA: 16.4
fatty_acid: 16.3
Benzoyl-CoA: 13.9
trans-1,2-CPDA: 11.8
Isobutyryl-CoA: 10.6
Acetyl-CoA: 9.3
3-Methylbutyryl-CoA: 0.0

ctg23_145

Search NORINE for peptide: strict or relaxed

PKS_AT (527..815): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 149.8
inactive: 67.8
Methoxymalonyl-CoA: 48.9
Methylmalonyl-CoA: 46.9
Ethylmalonyl-CoA: 31.4
Propionyl-CoA: 29.1
2-Methylbutyryl-CoA: 27.5
fatty_acid: 24.0
CHC-CoA: 21.4
Isobutyryl-CoA: 20.6
Benzoyl-CoA: 16.4
Acetyl-CoA: 14.8
trans-1,2-CPDA: 14.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (1981..2390): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg23_146

PKS_AT (531..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 146.9
inactive: 78.3
Methoxymalonyl-CoA: 78.1
Methylmalonyl-CoA: 62.6
Isobutyryl-CoA: 47.4
Propionyl-CoA: 41.7
Ethylmalonyl-CoA: 32.3
Benzoyl-CoA: 30.0
Acetyl-CoA: 28.8
3-Methylbutyryl-CoA: 26.7
2-Methylbutyryl-CoA: 22.7
fatty_acid: 19.2
CHC-CoA: 18.6
trans-1,2-CPDA: 11.3

ctg23_147

Search NORINE for peptide: strict or relaxed

CAL_domain (227..642): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 16.1
Acetyl-CoA: 14.1
shikimic_acid: 0.0
NH2: 0.0
AHBA: 0.0

AMP-binding (1826..2216): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

NZ_JAFREP010000002.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 377,304 - 420,302 nt. (total: 42,999 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 377303 - 420302:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg23_237

Search NORINE for peptide: strict or relaxed

AMP-binding (465..873): X

NRPSPredictor2: glu, gln

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVedIGAamK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

NZ_JAFREP010000002.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 452,868 - 532,278 nt. (total: 79,411 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 5, location 452867 - 532278:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - pro) + (D-tyr - orn - leu - gly - thr) + (D-asn - D-asn - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg23_294

Search NORINE for peptide: strict or relaxed

AMP-binding (247..629): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1697..2084): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3702..4098): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLviK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg23_295

Search NORINE for peptide: strict or relaxed

AMP-binding (240..628): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAaTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 90% (moderate)

AMP-binding (1696..2092): orn

NRPSPredictor2: orn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

AMP-binding (2739..3146): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DilHFGwViK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (3786..4169): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (4800..5195): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg23_296

Search NORINE for peptide: strict or relaxed

AMP-binding (456..832): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DtESIGSVCK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 90% (moderate)

AMP-binding (1462..1848): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

NZ_JAFREP010000035.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 7,355 - 63,268 nt. (total: 55,914 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 7354 - 63268:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - ohmal) + (X - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg27_22

Search NORINE for peptide: strict or relaxed

AMP-binding (570..963): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: GILhfsvGpK
Nearest Stachelhaus code:: tcl
Stachelhaus code match:: 50% (weak)

PKS_AT (1698..1993): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.2
inactive: 90.0
Methoxymalonyl-CoA: 62.9
Methylmalonyl-CoA: 51.8
Isobutyryl-CoA: 44.3
Propionyl-CoA: 25.5
Benzoyl-CoA: 25.2
Ethylmalonyl-CoA: 21.3
CHC-CoA: 19.9
2-Methylbutyryl-CoA: 18.6
trans-1,2-CPDA: 9.7
fatty_acid: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg27_23

Search NORINE for peptide: strict or relaxed

AMP-binding (493..892): ser

NRPSPredictor2: ser

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHlSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

PKS_AT (1616..1915): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 154.7
inactive: 111.2
Methoxymalonyl-CoA: 49.6
Propionyl-CoA: 40.1
Methylmalonyl-CoA: 35.6
Benzoyl-CoA: 25.7
Ethylmalonyl-CoA: 23.6
Isobutyryl-CoA: 18.9
fatty_acid: 13.8
Acetyl-CoA: 12.9
2-Methylbutyryl-CoA: 12.6
trans-1,2-CPDA: 10.8
CHC-CoA: 10.4
3-Methylbutyryl-CoA: 0.0

NZ_JAFREP010000038.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 55,075 - 96,430 nt. (total: 41,356 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NZ_JAFREP010000042.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 43,769 nt. (total: 43,769 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 43769:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg33_13

Search NORINE for peptide: strict or relaxed

AMP-binding (201..592): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

NZ_JAFREP010000003.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 34,401 - 75,441 nt. (total: 41,041 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NZ_JAFREP010000003.1 - Region 2 - thioamitides,thiopeptide

Download region GenBank file

Download region SVG

Location: 138,175 - 168,369 nt. (total: 30,195 nt) Show pHMM detection rules used

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)
thioamitides: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Thiopeptides

Thiopeptide predictions

No core peptides found.

Thiopeptides

Core peptide predictions

No core peptides found.

NZ_JAFREP010000003.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 287,391 - 344,045 nt. (total: 56,655 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 3, location 287390 - 344045:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - cys - cys - cys - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg34_212

Search NORINE for peptide: strict or relaxed

AMP-binding (543..947): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNiasIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 70% (weak)

AMP-binding (1625..2036): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLyNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (2709..3109): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

AMP-binding (3788..4185): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSMIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

AMP-binding (4869..5265): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: srviMdLfWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 40% (weak)

NZ_JAFREP010000003.1 - Region 4 - NRPS,NRPS-like,transAT-PKS

Download region GenBank file

Download region SVG

Location: 395,107 - 511,099 nt. (total: 115,993 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 395106 - 511099:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal - Me-ohmal - OMe-mal - mal - ser - mal - Me-ccmal - Me-ohmal - ccmal - ccmal - Me-ccmal) + (mal) + (ser - mal - ohmal - ccmal) + (mal - ccmal - ohmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 395106 - 489606:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal - Me-ohmal - OMe-mal - mal - ser - mal - Me-ccmal - Me-ohmal - ccmal - ccmal - Me-ccmal) + (mal) + (ser - mal - ohmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 458343 - 511099:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal - Me-ohmal - OMe-mal - mal - ser - mal - Me-ccmal - Me-ohmal - ccmal - ccmal - Me-ccmal) + (mal) + (ser - mal - ohmal - ccmal) + (mal - ccmal - ohmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg34_279

PKS_AT (4..281): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 83.7
inactive: 34.2
Methoxymalonyl-CoA: 28.4
Methylmalonyl-CoA: 25.5
Propionyl-CoA: 25.3
2-Methylbutyryl-CoA: 18.7
fatty_acid: 18.5
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg34_286

Search NORINE for peptide: strict or relaxed

AMP-binding (6222..6618): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg34_288

Search NORINE for peptide: strict or relaxed

AMP-binding (28..424): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

NZ_JAFREP010000043.1 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 2,500 - 54,071 nt. (total: 51,572 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 2499 - 54071:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 2499 - 49594:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 9736 - 54071:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg35_16

PKS_AT (1202..1489): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 55.7
Methoxymalonyl-CoA: 31.1
Methylmalonyl-CoA: 27.1
Propionyl-CoA: 15.2
inactive: 11.4
Ethylmalonyl-CoA: 7.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg35_17

PKS_AT (611..824): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 9.0
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

NZ_JAFREP010000045.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 11,080 - 21,524 nt. (total: 10,445 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NZ_JAFREP010000045.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 55,395 - 66,339 nt. (total: 10,945 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NZ_JAFREP010000047.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 54,589 nt. (total: 54,589 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 54589:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 27043:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 7128 - 54589:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg39_7

Search NORINE for peptide: strict or relaxed

AMP-binding (11..402): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASdiGvICK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 70% (weak)

ctg39_22

Search NORINE for peptide: strict or relaxed

AMP-binding (506..921): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMEiLGsIcK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

AMP-binding (1591..1991): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsWHmSLIEK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

NZ_JAFREP010000049.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 19,217 - 41,097 nt. (total: 21,881 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NZ_JAFREP010000050.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 7,071 - 52,542 nt. (total: 45,472 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 7070 - 52542:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg42_21

Search NORINE for peptide: strict or relaxed

CAL_domain (33..490): pk

minowa: AHBA

Prediction, score:

AHBA: 25.0
fatty_acid: 20.6
shikimic_acid: 17.3
NH2: 11.2
Acetyl-CoA: -1.6

PKS_AT (1657..1980): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 107.7
inactive: 74.0
Methoxymalonyl-CoA: 61.0
Methylmalonyl-CoA: 45.8
Propionyl-CoA: 32.2
Ethylmalonyl-CoA: 25.3
Benzoyl-CoA: 15.8
3-Methylbutyryl-CoA: 12.9
2-Methylbutyryl-CoA: 12.3
Acetyl-CoA: 11.7
CHC-CoA: 10.9
Isobutyryl-CoA: 10.2
trans-1,2-CPDA: 9.4
fatty_acid: 0.0

AMP-binding (3151..3554): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWmFGLvhK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

NZ_JAFREP010000004.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 126,642 - 189,488 nt. (total: 62,847 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 126641 - 189488:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X - pro - thr - pro) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg45_114

Search NORINE for peptide: strict or relaxed

AMP-binding (509..906): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: neMqvhngAK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 30% (weak)

ctg45_115

Search NORINE for peptide: strict or relaxed

AMP-binding (453..844): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DAgDvtqVgK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 50% (weak)

AMP-binding (1495..1886): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALViGdVlK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

AMP-binding (2536..2926): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpaDIGaVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

AMP-binding (3577..3966): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQtcsqVIK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 60% (weak)

AMP-binding (4612..5013): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5680..6076): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQVvsqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

NZ_JAFREP010000004.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 357,810 - 402,324 nt. (total: 44,515 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 357809 - 402324:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg45_265

PKS_AT (521..801): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 58.3%; Methoxymalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 88.8
Methoxymalonyl-CoA: 85.6
Methylmalonyl-CoA: 68.2
Ethylmalonyl-CoA: 53.0
Isobutyryl-CoA: 46.2
inactive: 38.9
Propionyl-CoA: 38.0
2-Methylbutyryl-CoA: 34.9
Acetyl-CoA: 29.6
CHC-CoA: 21.6
trans-1,2-CPDA: 15.6
Benzoyl-CoA: 14.1
3-Methylbutyryl-CoA: 13.3
fatty_acid: 10.3

NZ_JAFREP010000005.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 31,103 nt. (total: 31,103 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NZ_JAFREP010000005.1 - Region 2 - RRE-containing,lassopeptide

Download region GenBank file

Download region SVG

Location: 64,292 - 87,941 nt. (total: 23,650 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptide(s) for ctg58_54 - Putative Class II

ctg58_54 leader / core peptide / cleaved tail: MNVKQPNANQHDANISMVKKPYEKPVMVCRGDVAELTL - SGFNAGSDSKATGDFVIAS

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Lasso peptides

Core peptide predictions

ctg58_54 - Class II: Cleavage pHMM score: -0.50; RODEO score: 21; Monoisotopic mass: 1811.8 Da; Molecular weight: 1812.9 Da; Number of bridges: 0

NZ_JAFREP010000005.1 - Region 3 - RRE-containing

Download region GenBank file

Download region SVG

Location: 91,542 - 111,838 nt. (total: 20,297 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NZ_JAFREP010000006.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 718 - 62,324 nt. (total: 61,607 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 717 - 62324:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ccmal) + (ccmal - ohmal) + (mal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg69_4

Search NORINE for peptide: strict or relaxed

AMP-binding (14..424): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DlhTVAyIaK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

ctg69_8

PKS_AT (1818..2103): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 179.0
inactive: 123.6
Methylmalonyl-CoA: 65.9
Methoxymalonyl-CoA: 64.1
Propionyl-CoA: 37.6
Ethylmalonyl-CoA: 36.3
2-Methylbutyryl-CoA: 25.1
Acetyl-CoA: 21.7
Isobutyryl-CoA: 19.5
CHC-CoA: 18.9
trans-1,2-CPDA: 17.0
Benzoyl-CoA: 16.4
fatty_acid: 16.1
3-Methylbutyryl-CoA: 12.8

ctg69_9

PKS_AT (3175..3466): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.0
inactive: 141.3
Methylmalonyl-CoA: 86.8
Methoxymalonyl-CoA: 82.3
Propionyl-CoA: 58.4
Isobutyryl-CoA: 57.7
Ethylmalonyl-CoA: 54.0
2-Methylbutyryl-CoA: 53.6
Acetyl-CoA: 35.6
Benzoyl-CoA: 32.5
CHC-CoA: 30.2
trans-1,2-CPDA: 24.2
fatty_acid: 18.7
3-Methylbutyryl-CoA: 7.6

ctg69_10

Search NORINE for peptide: strict or relaxed

AMP-binding (541..934): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

PKS_AT (3282..3574): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.1
inactive: 133.5
Methylmalonyl-CoA: 60.6
Methoxymalonyl-CoA: 52.9
Propionyl-CoA: 34.3
fatty_acid: 32.3
Benzoyl-CoA: 29.6
Isobutyryl-CoA: 27.7
2-Methylbutyryl-CoA: 19.2
CHC-CoA: 14.3
Ethylmalonyl-CoA: 14.0
Acetyl-CoA: 13.9
trans-1,2-CPDA: 11.8
3-Methylbutyryl-CoA: 0.0

NZ_JAFREP010000006.1 - Region 2 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 305,831 - 399,982 nt. (total: 94,152 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 305830 - 399982:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr) + (ohmal) + (mal - D-thr) + (X - thr - Me-ohmal) + (gly) + (X) + (D-ile - asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 305830 - 344301:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - thr - Me-ohmal) + (gly) + (X) + (D-ile - asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 308606 - 399982:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr) + (ohmal) + (mal - D-thr) + (X - thr - Me-ohmal) + (gly) + (X) + (D-ile - asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg69_201

Search NORINE for peptide: strict or relaxed

AMP-binding (423..710): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg69_203

Search NORINE for peptide: strict or relaxed

AMP-binding (499..893): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAlFmGVTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1998..2384): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLsKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg69_204

Search NORINE for peptide: strict or relaxed

AMP-binding (501..857): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: sALaLqaLvK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 50% (weak)

ctg69_205

Search NORINE for peptide: strict or relaxed

AMP-binding (528..932): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg69_206

Search NORINE for peptide: strict or relaxed

AMP-binding (1007..1401): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfGsqiK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (2049..2453): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

PKS_AT (3169..3447): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.6
inactive: 75.6
Methoxymalonyl-CoA: 64.4
Methylmalonyl-CoA: 44.7
Propionyl-CoA: 40.9
2-Methylbutyryl-CoA: 24.3
CHC-CoA: 21.9
Ethylmalonyl-CoA: 16.4
fatty_acid: 16.3
Benzoyl-CoA: 13.9
trans-1,2-CPDA: 11.8
Isobutyryl-CoA: 10.6
Acetyl-CoA: 9.3
3-Methylbutyryl-CoA: 0.0

ctg69_207

Search NORINE for peptide: strict or relaxed

PKS_AT (527..815): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 149.8
inactive: 67.8
Methoxymalonyl-CoA: 48.9
Methylmalonyl-CoA: 46.9
Ethylmalonyl-CoA: 31.4
Propionyl-CoA: 29.1
2-Methylbutyryl-CoA: 27.5
fatty_acid: 24.0
CHC-CoA: 21.4
Isobutyryl-CoA: 20.6
Benzoyl-CoA: 16.4
Acetyl-CoA: 14.8
trans-1,2-CPDA: 14.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (1981..2390): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg69_208

PKS_AT (531..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 146.9
inactive: 78.3
Methoxymalonyl-CoA: 78.1
Methylmalonyl-CoA: 62.6
Isobutyryl-CoA: 47.4
Propionyl-CoA: 41.7
Ethylmalonyl-CoA: 32.3
Benzoyl-CoA: 30.0
Acetyl-CoA: 28.8
3-Methylbutyryl-CoA: 26.7
2-Methylbutyryl-CoA: 22.7
fatty_acid: 19.2
CHC-CoA: 18.6
trans-1,2-CPDA: 11.3

ctg69_209

Search NORINE for peptide: strict or relaxed

CAL_domain (227..642): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 16.1
Acetyl-CoA: 14.1
shikimic_acid: 0.0
NH2: 0.0
AHBA: 0.0

AMP-binding (1826..2216): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

NZ_JAFREP010000007.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 65,542 - 124,982 nt. (total: 59,441 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 65541 - 124982:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - NMe-val - X - ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg73_53

Search NORINE for peptide: strict or relaxed

AMP-binding (454..862): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIaMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 90% (moderate)

AMP-binding (1518..1911): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (2981..3370): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAfviVAImK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

PKS_AT (4094..4377): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 117.5
Methoxymalonyl-CoA: 71.7
Methylmalonyl-CoA: 71.5
inactive: 45.9
Ethylmalonyl-CoA: 44.4
Propionyl-CoA: 40.4
2-Methylbutyryl-CoA: 31.4
Isobutyryl-CoA: 28.0
trans-1,2-CPDA: 24.0
CHC-CoA: 21.0
Acetyl-CoA: 19.5
Benzoyl-CoA: 17.2
fatty_acid: 14.6
3-Methylbutyryl-CoA: 0.0

ctg73_54

Search NORINE for peptide: strict or relaxed

AMP-binding (508..925): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvESvgAVsK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

NZ_JAFREP010000007.1 - Region 2 - arylpolyene

Download region GenBank file

Download region SVG

Location: 302,781 - 344,007 nt. (total: 41,227 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NZ_JAFREP010000008.1 - Region 1 - hglE-KS

Download region GenBank file

Download region SVG

Location: 104,802 - 159,892 nt. (total: 55,091 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 104801 - 159892:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg74_90

PKS_AT (574..869): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 112.5
Methylmalonyl-CoA: 55.7
Methoxymalonyl-CoA: 55.7
inactive: 43.9
CHC-CoA: 30.0
Propionyl-CoA: 24.9
2-Methylbutyryl-CoA: 15.1
Isobutyryl-CoA: 12.7
fatty_acid: 11.4
Ethylmalonyl-CoA: 9.2
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

NZ_JAFREP010000010.1 - Region 1 - NRPS,NRPS-like,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 20,410 - 117,463 nt. (total: 97,054 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 20409 - 117463:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - mal - ohmal) + (mal - gly - Me-ccmal - mal - mal) + (ser - mal - ccmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 20409 - 61681:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - mal - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 24192 - 117463:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - mal - ohmal) + (mal - gly - Me-ccmal - mal - mal) + (ser - mal - ccmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg76_35

PKS_AT (4..283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.7
inactive: 23.8
Methoxymalonyl-CoA: 17.7
fatty_acid: 17.3
Methylmalonyl-CoA: 10.2
Isobutyryl-CoA: 9.0
trans-1,2-CPDA: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg76_41

Search NORINE for peptide: strict or relaxed

AMP-binding (13..415): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg76_42

Search NORINE for peptide: strict or relaxed

AMP-binding (1196..1591): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg76_43

Search NORINE for peptide: strict or relaxed

AMP-binding (11..411): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

NZ_JAFREP010000010.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 140,623 - 198,102 nt. (total: 57,480 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 140622 - 198102:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - mal - mal - mal) + (mal - X - ccmal - mal) + (mal - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg76_48

Search NORINE for peptide: strict or relaxed

AMP-binding (1997..2407): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

ctg76_49

Search NORINE for peptide: strict or relaxed

AMP-binding (1763..2158): ser

NRPSPredictor2: ser

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

NZ_JAFREP010000010.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 207,857 - 251,795 nt. (total: 43,939 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 5, location 207856 - 251795:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg76_82

Search NORINE for peptide: strict or relaxed

AMP-binding (265..653): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: pATKVdElaK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 60% (weak)