TARA_SAMEA6039747_MAG_00000027 - 58 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

TARA_SAMEA6039747_MAG_00000027-scaffold_2

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	hglE-KS	1	33,080

TARA_SAMEA6039747_MAG_00000027-scaffold_11

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	NRPS	1	32,974

TARA_SAMEA6039747_MAG_00000027-scaffold_18

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	NRPS	1	28,459

TARA_SAMEA6039747_MAG_00000027-scaffold_21

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	NRPS-like	1	26,070

TARA_SAMEA6039747_MAG_00000027-scaffold_26

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	T1PKS,NRPS	1	25,254

TARA_SAMEA6039747_MAG_00000027-scaffold_29

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	NRPS	1	23,272

TARA_SAMEA6039747_MAG_00000027-scaffold_32

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	lanthipeptide-class-i	1	15,726

TARA_SAMEA6039747_MAG_00000027-scaffold_34

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	terpene	1	14,384

TARA_SAMEA6039747_MAG_00000027-scaffold_52

Region	Type	From	To	Most similar known cluster		Similarity
Region 52.1	T1PKS,NRPS	1	19,805

TARA_SAMEA6039747_MAG_00000027-scaffold_64

Region	Type	From	To	Most similar known cluster		Similarity
Region 64.1	ladderane	1	18,747

TARA_SAMEA6039747_MAG_00000027-scaffold_67

Region	Type	From	To	Most similar known cluster		Similarity
Region 67.1	lanthipeptide-class-iv	4,903	18,482

TARA_SAMEA6039747_MAG_00000027-scaffold_79

Region	Type	From	To	Most similar known cluster		Similarity
Region 79.1	NRPS	1	17,711

TARA_SAMEA6039747_MAG_00000027-scaffold_86

Region	Type	From	To	Most similar known cluster		Similarity
Region 86.1	T1PKS,amglyccycl	1	17,240

TARA_SAMEA6039747_MAG_00000027-scaffold_91

Region	Type	From	To	Most similar known cluster		Similarity
Region 91.1	NRPS	1	17,069

TARA_SAMEA6039747_MAG_00000027-scaffold_94

Region	Type	From	To	Most similar known cluster		Similarity
Region 94.1	NRPS,NRPS-like	1	17,030

TARA_SAMEA6039747_MAG_00000027-scaffold_105

Region	Type	From	To	Most similar known cluster		Similarity
Region 105.1	T1PKS	1	16,318

TARA_SAMEA6039747_MAG_00000027-scaffold_131

Region	Type	From	To	Most similar known cluster		Similarity
Region 131.1	T3PKS	1	15,182

TARA_SAMEA6039747_MAG_00000027-scaffold_144

Region	Type	From	To	Most similar known cluster		Similarity
Region 144.1	NRPS	1	14,690

TARA_SAMEA6039747_MAG_00000027-scaffold_145

Region	Type	From	To	Most similar known cluster		Similarity
Region 145.1	NRPS,T1PKS	1	14,670

TARA_SAMEA6039747_MAG_00000027-scaffold_183

Region	Type	From	To	Most similar known cluster		Similarity
Region 183.1	T1PKS,NRPS	1	13,475

TARA_SAMEA6039747_MAG_00000027-scaffold_226

Region	Type	From	To	Most similar known cluster		Similarity
Region 226.1	NRPS	1	12,235

TARA_SAMEA6039747_MAG_00000027-scaffold_229

Region	Type	From	To	Most similar known cluster		Similarity
Region 229.1	T3PKS	1	12,181

TARA_SAMEA6039747_MAG_00000027-scaffold_259

Region	Type	From	To	Most similar known cluster		Similarity
Region 259.1	ranthipeptide	1	11,504

TARA_SAMEA6039747_MAG_00000027-scaffold_271

Region	Type	From	To	Most similar known cluster		Similarity
Region 271.1	NRPS-like,T1PKS	1	11,275

TARA_SAMEA6039747_MAG_00000027-scaffold_276

Region	Type	From	To	Most similar known cluster		Similarity
Region 276.1	RRE-containing	1	11,210

TARA_SAMEA6039747_MAG_00000027-scaffold_277

Region	Type	From	To	Most similar known cluster		Similarity
Region 277.1	butyrolactone	1,116	11,209

TARA_SAMEA6039747_MAG_00000027-scaffold_278

Region	Type	From	To	Most similar known cluster		Similarity
Region 278.1	NRPS	1	11,201

TARA_SAMEA6039747_MAG_00000027-scaffold_283

Region	Type	From	To	Most similar known cluster		Similarity
Region 283.1	T1PKS	1	11,025

TARA_SAMEA6039747_MAG_00000027-scaffold_286

Region	Type	From	To	Most similar known cluster		Similarity
Region 286.1	NRPS	1	10,979

TARA_SAMEA6039747_MAG_00000027-scaffold_288

Region	Type	From	To	Most similar known cluster		Similarity
Region 288.1	lassopeptide	1	10,961

TARA_SAMEA6039747_MAG_00000027-scaffold_293

Region	Type	From	To	Most similar known cluster		Similarity
Region 293.1	NRPS	1	10,926

TARA_SAMEA6039747_MAG_00000027-scaffold_306

Region	Type	From	To	Most similar known cluster		Similarity
Region 306.1	NRPS	1	10,633

TARA_SAMEA6039747_MAG_00000027-scaffold_320

Region	Type	From	To	Most similar known cluster		Similarity
Region 320.1	NRPS	1	10,385

TARA_SAMEA6039747_MAG_00000027-scaffold_326

Region	Type	From	To	Most similar known cluster		Similarity
Region 326.1	LAP,siderophore	1	10,328

TARA_SAMEA6039747_MAG_00000027-scaffold_332

Region	Type	From	To	Most similar known cluster		Similarity
Region 332.1	lanthipeptide-class-i	1	10,250

TARA_SAMEA6039747_MAG_00000027-scaffold_336

Region	Type	From	To	Most similar known cluster		Similarity
Region 336.1	NRPS-like	1	10,070

TARA_SAMEA6039747_MAG_00000027-scaffold_338

Region	Type	From	To	Most similar known cluster		Similarity
Region 338.1	NRPS	1	10,060

TARA_SAMEA6039747_MAG_00000027-scaffold_413

Region	Type	From	To	Most similar known cluster		Similarity
Region 413.1	T1PKS	1	9,104

TARA_SAMEA6039747_MAG_00000027-scaffold_428

Region	Type	From	To	Most similar known cluster		Similarity
Region 428.1	NRPS	1	8,963

TARA_SAMEA6039747_MAG_00000027-scaffold_438

Region	Type	From	To	Most similar known cluster		Similarity
Region 438.1	NRPS-like,NRPS	1	8,846

TARA_SAMEA6039747_MAG_00000027-scaffold_465

Region	Type	From	To	Most similar known cluster		Similarity
Region 465.1	NRPS	1	8,564

TARA_SAMEA6039747_MAG_00000027-scaffold_483

Region	Type	From	To	Most similar known cluster		Similarity
Region 483.1	NRPS	1	8,292

TARA_SAMEA6039747_MAG_00000027-scaffold_557

Region	Type	From	To	Most similar known cluster		Similarity
Region 557.1	NRPS	1	7,483

TARA_SAMEA6039747_MAG_00000027-scaffold_575

Region	Type	From	To	Most similar known cluster		Similarity
Region 575.1	NRPS	1	7,394

TARA_SAMEA6039747_MAG_00000027-scaffold_602

Region	Type	From	To	Most similar known cluster		Similarity
Region 602.1	NRPS	1	7,147

TARA_SAMEA6039747_MAG_00000027-scaffold_636

Region	Type	From	To	Most similar known cluster		Similarity
Region 636.1	NRPS	1	6,834

TARA_SAMEA6039747_MAG_00000027-scaffold_659

Region	Type	From	To	Most similar known cluster		Similarity
Region 659.1	NRPS	1	6,637

TARA_SAMEA6039747_MAG_00000027-scaffold_673

Region	Type	From	To	Most similar known cluster		Similarity
Region 673.1	NRPS	1	6,575

TARA_SAMEA6039747_MAG_00000027-scaffold_676

Region	Type	From	To	Most similar known cluster		Similarity
Region 676.1	lanthipeptide-class-ii	1	6,571

TARA_SAMEA6039747_MAG_00000027-scaffold_679

Region	Type	From	To	Most similar known cluster		Similarity
Region 679.1	NRPS-like,T1PKS	1	6,548

TARA_SAMEA6039747_MAG_00000027-scaffold_713

Region	Type	From	To	Most similar known cluster		Similarity
Region 713.1	NRPS	1	6,350

TARA_SAMEA6039747_MAG_00000027-scaffold_726

Region	Type	From	To	Most similar known cluster		Similarity
Region 726.1	NRPS,NRPS-like	1	6,293

TARA_SAMEA6039747_MAG_00000027-scaffold_809

Region	Type	From	To	Most similar known cluster		Similarity
Region 809.1	NRPS	1	5,791

TARA_SAMEA6039747_MAG_00000027-scaffold_864

Region	Type	From	To	Most similar known cluster		Similarity
Region 864.1	NRPS,NRPS-like	1	5,496

TARA_SAMEA6039747_MAG_00000027-scaffold_869

Region	Type	From	To	Most similar known cluster		Similarity
Region 869.1	NRPS	1	5,479

TARA_SAMEA6039747_MAG_00000027-scaffold_886

Region	Type	From	To	Most similar known cluster		Similarity
Region 886.1	RiPP-like	1	5,375

TARA_SAMEA6039747_MAG_00000027-scaffold_937

Region	Type	From	To	Most similar known cluster		Similarity
Region 937.1	terpene	1	5,135

TARA_SAMEA6039747_MAG_00000027-scaffold_968

Region	Type	From	To	Most similar known cluster		Similarity
Region 968.1	terpene	1	5,009

No secondary metabolite regions were found in these records:: TARA_SAMEA6039747_MAG_00000027-scaffold_1; TARA_SAMEA6039747_MAG_00000027-scaffold_3; TARA_SAMEA6039747_MAG_00000027-scaffold_4; TARA_SAMEA6039747_MAG_00000027-scaffold_5; TARA_SAMEA6039747_MAG_00000027-scaffold_6; TARA_SAMEA6039747_MAG_00000027-scaffold_7; TARA_SAMEA6039747_MAG_00000027-scaffold_8; TARA_SAMEA6039747_MAG_00000027-scaffold_9; TARA_SAMEA6039747_MAG_00000027-scaffold_10; TARA_SAMEA6039747_MAG_00000027-scaffold_12; TARA_SAMEA6039747_MAG_00000027-scaffold_13; TARA_SAMEA6039747_MAG_00000027-scaffold_14; TARA_SAMEA6039747_MAG_00000027-scaffold_15; TARA_SAMEA6039747_MAG_00000027-scaffold_16; TARA_SAMEA6039747_MAG_00000027-scaffold_17; TARA_SAMEA6039747_MAG_00000027-scaffold_19; TARA_SAMEA6039747_MAG_00000027-scaffold_20; TARA_SAMEA6039747_MAG_00000027-scaffold_22; TARA_SAMEA6039747_MAG_00000027-scaffold_23; TARA_SAMEA6039747_MAG_00000027-scaffold_24; TARA_SAMEA6039747_MAG_00000027-scaffold_25; TARA_SAMEA6039747_MAG_00000027-scaffold_27; TARA_SAMEA6039747_MAG_00000027-scaffold_28; TARA_SAMEA6039747_MAG_00000027-scaffold_30; TARA_SAMEA6039747_MAG_00000027-scaffold_31; TARA_SAMEA6039747_MAG_00000027-scaffold_33; TARA_SAMEA6039747_MAG_00000027-scaffold_35; TARA_SAMEA6039747_MAG_00000027-scaffold_36; TARA_SAMEA6039747_MAG_00000027-scaffold_37; TARA_SAMEA6039747_MAG_00000027-scaffold_38; TARA_SAMEA6039747_MAG_00000027-scaffold_39; TARA_SAMEA6039747_MAG_00000027-scaffold_40; TARA_SAMEA6039747_MAG_00000027-scaffold_41; TARA_SAMEA6039747_MAG_00000027-scaffold_42; TARA_SAMEA6039747_MAG_00000027-scaffold_43; TARA_SAMEA6039747_MAG_00000027-scaffold_44; TARA_SAMEA6039747_MAG_00000027-scaffold_45; TARA_SAMEA6039747_MAG_00000027-scaffold_46; TARA_SAMEA6039747_MAG_00000027-scaffold_47; TARA_SAMEA6039747_MAG_00000027-scaffold_48; TARA_SAMEA6039747_MAG_00000027-scaffold_49; TARA_SAMEA6039747_MAG_00000027-scaffold_50; TARA_SAMEA6039747_MAG_00000027-scaffold_51; TARA_SAMEA6039747_MAG_00000027-scaffold_53; TARA_SAMEA6039747_MAG_00000027-scaffold_54; TARA_SAMEA6039747_MAG_00000027-scaffold_55; TARA_SAMEA6039747_MAG_00000027-scaffold_56; TARA_SAMEA6039747_MAG_00000027-scaffold_57; TARA_SAMEA6039747_MAG_00000027-scaffold_58; TARA_SAMEA6039747_MAG_00000027-scaffold_59; TARA_SAMEA6039747_MAG_00000027-scaffold_60; TARA_SAMEA6039747_MAG_00000027-scaffold_61; TARA_SAMEA6039747_MAG_00000027-scaffold_62; TARA_SAMEA6039747_MAG_00000027-scaffold_63; TARA_SAMEA6039747_MAG_00000027-scaffold_65; TARA_SAMEA6039747_MAG_00000027-scaffold_66; TARA_SAMEA6039747_MAG_00000027-scaffold_68; TARA_SAMEA6039747_MAG_00000027-scaffold_69; TARA_SAMEA6039747_MAG_00000027-scaffold_70; TARA_SAMEA6039747_MAG_00000027-scaffold_71; TARA_SAMEA6039747_MAG_00000027-scaffold_72; TARA_SAMEA6039747_MAG_00000027-scaffold_73; TARA_SAMEA6039747_MAG_00000027-scaffold_74; TARA_SAMEA6039747_MAG_00000027-scaffold_75; TARA_SAMEA6039747_MAG_00000027-scaffold_76; TARA_SAMEA6039747_MAG_00000027-scaffold_77; TARA_SAMEA6039747_MAG_00000027-scaffold_78; TARA_SAMEA6039747_MAG_00000027-scaffold_80; TARA_SAMEA6039747_MAG_00000027-scaffold_81; TARA_SAMEA6039747_MAG_00000027-scaffold_82; TARA_SAMEA6039747_MAG_00000027-scaffold_83; TARA_SAMEA6039747_MAG_00000027-scaffold_84; TARA_SAMEA6039747_MAG_00000027-scaffold_85; TARA_SAMEA6039747_MAG_00000027-scaffold_87; TARA_SAMEA6039747_MAG_00000027-scaffold_88; TARA_SAMEA6039747_MAG_00000027-scaffold_89; TARA_SAMEA6039747_MAG_00000027-scaffold_90; TARA_SAMEA6039747_MAG_00000027-scaffold_92; TARA_SAMEA6039747_MAG_00000027-scaffold_93; TARA_SAMEA6039747_MAG_00000027-scaffold_95; TARA_SAMEA6039747_MAG_00000027-scaffold_96; TARA_SAMEA6039747_MAG_00000027-scaffold_97; TARA_SAMEA6039747_MAG_00000027-scaffold_98; TARA_SAMEA6039747_MAG_00000027-scaffold_99; TARA_SAMEA6039747_MAG_00000027-scaffold_100; TARA_SAMEA6039747_MAG_00000027-scaffold_101; TARA_SAMEA6039747_MAG_00000027-scaffold_102; TARA_SAMEA6039747_MAG_00000027-scaffold_103; TARA_SAMEA6039747_MAG_00000027-scaffold_104; TARA_SAMEA6039747_MAG_00000027-scaffold_106; TARA_SAMEA6039747_MAG_00000027-scaffold_107; TARA_SAMEA6039747_MAG_00000027-scaffold_108; TARA_SAMEA6039747_MAG_00000027-scaffold_109; TARA_SAMEA6039747_MAG_00000027-scaffold_110; TARA_SAMEA6039747_MAG_00000027-scaffold_111; TARA_SAMEA6039747_MAG_00000027-scaffold_112; TARA_SAMEA6039747_MAG_00000027-scaffold_113; TARA_SAMEA6039747_MAG_00000027-scaffold_114; TARA_SAMEA6039747_MAG_00000027-scaffold_115; TARA_SAMEA6039747_MAG_00000027-scaffold_116; TARA_SAMEA6039747_MAG_00000027-scaffold_117; TARA_SAMEA6039747_MAG_00000027-scaffold_118; TARA_SAMEA6039747_MAG_00000027-scaffold_119; TARA_SAMEA6039747_MAG_00000027-scaffold_120; TARA_SAMEA6039747_MAG_00000027-scaffold_121; TARA_SAMEA6039747_MAG_00000027-scaffold_122; TARA_SAMEA6039747_MAG_00000027-scaffold_123; TARA_SAMEA6039747_MAG_00000027-scaffold_124; TARA_SAMEA6039747_MAG_00000027-scaffold_125; TARA_SAMEA6039747_MAG_00000027-scaffold_126; TARA_SAMEA6039747_MAG_00000027-scaffold_127; TARA_SAMEA6039747_MAG_00000027-scaffold_128; TARA_SAMEA6039747_MAG_00000027-scaffold_129; TARA_SAMEA6039747_MAG_00000027-scaffold_130; TARA_SAMEA6039747_MAG_00000027-scaffold_132; TARA_SAMEA6039747_MAG_00000027-scaffold_133; TARA_SAMEA6039747_MAG_00000027-scaffold_134; TARA_SAMEA6039747_MAG_00000027-scaffold_135; TARA_SAMEA6039747_MAG_00000027-scaffold_136; TARA_SAMEA6039747_MAG_00000027-scaffold_137; TARA_SAMEA6039747_MAG_00000027-scaffold_138; TARA_SAMEA6039747_MAG_00000027-scaffold_139; TARA_SAMEA6039747_MAG_00000027-scaffold_140; TARA_SAMEA6039747_MAG_00000027-scaffold_141; TARA_SAMEA6039747_MAG_00000027-scaffold_142; TARA_SAMEA6039747_MAG_00000027-scaffold_143; TARA_SAMEA6039747_MAG_00000027-scaffold_146; TARA_SAMEA6039747_MAG_00000027-scaffold_147; TARA_SAMEA6039747_MAG_00000027-scaffold_148; TARA_SAMEA6039747_MAG_00000027-scaffold_149; TARA_SAMEA6039747_MAG_00000027-scaffold_150; TARA_SAMEA6039747_MAG_00000027-scaffold_151; TARA_SAMEA6039747_MAG_00000027-scaffold_152; TARA_SAMEA6039747_MAG_00000027-scaffold_153; TARA_SAMEA6039747_MAG_00000027-scaffold_154; TARA_SAMEA6039747_MAG_00000027-scaffold_155; TARA_SAMEA6039747_MAG_00000027-scaffold_156; TARA_SAMEA6039747_MAG_00000027-scaffold_157; TARA_SAMEA6039747_MAG_00000027-scaffold_158; TARA_SAMEA6039747_MAG_00000027-scaffold_159; TARA_SAMEA6039747_MAG_00000027-scaffold_160; TARA_SAMEA6039747_MAG_00000027-scaffold_161; TARA_SAMEA6039747_MAG_00000027-scaffold_162; TARA_SAMEA6039747_MAG_00000027-scaffold_163; TARA_SAMEA6039747_MAG_00000027-scaffold_164; TARA_SAMEA6039747_MAG_00000027-scaffold_165; TARA_SAMEA6039747_MAG_00000027-scaffold_166; TARA_SAMEA6039747_MAG_00000027-scaffold_167; TARA_SAMEA6039747_MAG_00000027-scaffold_168; TARA_SAMEA6039747_MAG_00000027-scaffold_169; TARA_SAMEA6039747_MAG_00000027-scaffold_170; TARA_SAMEA6039747_MAG_00000027-scaffold_171; TARA_SAMEA6039747_MAG_00000027-scaffold_172; TARA_SAMEA6039747_MAG_00000027-scaffold_173; TARA_SAMEA6039747_MAG_00000027-scaffold_174; TARA_SAMEA6039747_MAG_00000027-scaffold_175; TARA_SAMEA6039747_MAG_00000027-scaffold_176; TARA_SAMEA6039747_MAG_00000027-scaffold_177; TARA_SAMEA6039747_MAG_00000027-scaffold_178; TARA_SAMEA6039747_MAG_00000027-scaffold_179; TARA_SAMEA6039747_MAG_00000027-scaffold_180; TARA_SAMEA6039747_MAG_00000027-scaffold_181; TARA_SAMEA6039747_MAG_00000027-scaffold_182; TARA_SAMEA6039747_MAG_00000027-scaffold_184; TARA_SAMEA6039747_MAG_00000027-scaffold_185; TARA_SAMEA6039747_MAG_00000027-scaffold_186; TARA_SAMEA6039747_MAG_00000027-scaffold_187; TARA_SAMEA6039747_MAG_00000027-scaffold_188; TARA_SAMEA6039747_MAG_00000027-scaffold_189; TARA_SAMEA6039747_MAG_00000027-scaffold_190; TARA_SAMEA6039747_MAG_00000027-scaffold_191; TARA_SAMEA6039747_MAG_00000027-scaffold_192; TARA_SAMEA6039747_MAG_00000027-scaffold_193; TARA_SAMEA6039747_MAG_00000027-scaffold_194; TARA_SAMEA6039747_MAG_00000027-scaffold_195; TARA_SAMEA6039747_MAG_00000027-scaffold_196; TARA_SAMEA6039747_MAG_00000027-scaffold_197; TARA_SAMEA6039747_MAG_00000027-scaffold_198; TARA_SAMEA6039747_MAG_00000027-scaffold_199; TARA_SAMEA6039747_MAG_00000027-scaffold_200; TARA_SAMEA6039747_MAG_00000027-scaffold_201; TARA_SAMEA6039747_MAG_00000027-scaffold_202; TARA_SAMEA6039747_MAG_00000027-scaffold_203; TARA_SAMEA6039747_MAG_00000027-scaffold_204; TARA_SAMEA6039747_MAG_00000027-scaffold_205; TARA_SAMEA6039747_MAG_00000027-scaffold_206; TARA_SAMEA6039747_MAG_00000027-scaffold_207; TARA_SAMEA6039747_MAG_00000027-scaffold_208; TARA_SAMEA6039747_MAG_00000027-scaffold_209; TARA_SAMEA6039747_MAG_00000027-scaffold_210; TARA_SAMEA6039747_MAG_00000027-scaffold_211; TARA_SAMEA6039747_MAG_00000027-scaffold_212; TARA_SAMEA6039747_MAG_00000027-scaffold_213; TARA_SAMEA6039747_MAG_00000027-scaffold_214; TARA_SAMEA6039747_MAG_00000027-scaffold_215; TARA_SAMEA6039747_MAG_00000027-scaffold_216; TARA_SAMEA6039747_MAG_00000027-scaffold_217; TARA_SAMEA6039747_MAG_00000027-scaffold_218; TARA_SAMEA6039747_MAG_00000027-scaffold_219; TARA_SAMEA6039747_MAG_00000027-scaffold_220; TARA_SAMEA6039747_MAG_00000027-scaffold_221; TARA_SAMEA6039747_MAG_00000027-scaffold_222; TARA_SAMEA6039747_MAG_00000027-scaffold_223; TARA_SAMEA6039747_MAG_00000027-scaffold_224; TARA_SAMEA6039747_MAG_00000027-scaffold_225; TARA_SAMEA6039747_MAG_00000027-scaffold_227; TARA_SAMEA6039747_MAG_00000027-scaffold_228; TARA_SAMEA6039747_MAG_00000027-scaffold_230; TARA_SAMEA6039747_MAG_00000027-scaffold_231; TARA_SAMEA6039747_MAG_00000027-scaffold_232; TARA_SAMEA6039747_MAG_00000027-scaffold_233; TARA_SAMEA6039747_MAG_00000027-scaffold_234; TARA_SAMEA6039747_MAG_00000027-scaffold_235; TARA_SAMEA6039747_MAG_00000027-scaffold_236; TARA_SAMEA6039747_MAG_00000027-scaffold_237; TARA_SAMEA6039747_MAG_00000027-scaffold_238; TARA_SAMEA6039747_MAG_00000027-scaffold_239; TARA_SAMEA6039747_MAG_00000027-scaffold_240; TARA_SAMEA6039747_MAG_00000027-scaffold_241; TARA_SAMEA6039747_MAG_00000027-scaffold_242; TARA_SAMEA6039747_MAG_00000027-scaffold_243; TARA_SAMEA6039747_MAG_00000027-scaffold_244; TARA_SAMEA6039747_MAG_00000027-scaffold_245; TARA_SAMEA6039747_MAG_00000027-scaffold_246; TARA_SAMEA6039747_MAG_00000027-scaffold_247; TARA_SAMEA6039747_MAG_00000027-scaffold_248; TARA_SAMEA6039747_MAG_00000027-scaffold_249; TARA_SAMEA6039747_MAG_00000027-scaffold_250; TARA_SAMEA6039747_MAG_00000027-scaffold_251; TARA_SAMEA6039747_MAG_00000027-scaffold_252; TARA_SAMEA6039747_MAG_00000027-scaffold_253; TARA_SAMEA6039747_MAG_00000027-scaffold_254; TARA_SAMEA6039747_MAG_00000027-scaffold_255; TARA_SAMEA6039747_MAG_00000027-scaffold_256; TARA_SAMEA6039747_MAG_00000027-scaffold_257; TARA_SAMEA6039747_MAG_00000027-scaffold_258; TARA_SAMEA6039747_MAG_00000027-scaffold_260; TARA_SAMEA6039747_MAG_00000027-scaffold_261; TARA_SAMEA6039747_MAG_00000027-scaffold_262; TARA_SAMEA6039747_MAG_00000027-scaffold_263; TARA_SAMEA6039747_MAG_00000027-scaffold_264; TARA_SAMEA6039747_MAG_00000027-scaffold_265; TARA_SAMEA6039747_MAG_00000027-scaffold_266; TARA_SAMEA6039747_MAG_00000027-scaffold_267; TARA_SAMEA6039747_MAG_00000027-scaffold_268; TARA_SAMEA6039747_MAG_00000027-scaffold_269; TARA_SAMEA6039747_MAG_00000027-scaffold_270; TARA_SAMEA6039747_MAG_00000027-scaffold_272; TARA_SAMEA6039747_MAG_00000027-scaffold_273; TARA_SAMEA6039747_MAG_00000027-scaffold_274; TARA_SAMEA6039747_MAG_00000027-scaffold_275; TARA_SAMEA6039747_MAG_00000027-scaffold_279; TARA_SAMEA6039747_MAG_00000027-scaffold_280; TARA_SAMEA6039747_MAG_00000027-scaffold_281; TARA_SAMEA6039747_MAG_00000027-scaffold_282; TARA_SAMEA6039747_MAG_00000027-scaffold_284; TARA_SAMEA6039747_MAG_00000027-scaffold_285; TARA_SAMEA6039747_MAG_00000027-scaffold_287; TARA_SAMEA6039747_MAG_00000027-scaffold_289; TARA_SAMEA6039747_MAG_00000027-scaffold_290; TARA_SAMEA6039747_MAG_00000027-scaffold_291; TARA_SAMEA6039747_MAG_00000027-scaffold_292; TARA_SAMEA6039747_MAG_00000027-scaffold_294; TARA_SAMEA6039747_MAG_00000027-scaffold_295; TARA_SAMEA6039747_MAG_00000027-scaffold_296; TARA_SAMEA6039747_MAG_00000027-scaffold_297; TARA_SAMEA6039747_MAG_00000027-scaffold_298; TARA_SAMEA6039747_MAG_00000027-scaffold_299; TARA_SAMEA6039747_MAG_00000027-scaffold_300; TARA_SAMEA6039747_MAG_00000027-scaffold_301; TARA_SAMEA6039747_MAG_00000027-scaffold_302; TARA_SAMEA6039747_MAG_00000027-scaffold_303; TARA_SAMEA6039747_MAG_00000027-scaffold_304; TARA_SAMEA6039747_MAG_00000027-scaffold_305; TARA_SAMEA6039747_MAG_00000027-scaffold_307; TARA_SAMEA6039747_MAG_00000027-scaffold_308; TARA_SAMEA6039747_MAG_00000027-scaffold_309; TARA_SAMEA6039747_MAG_00000027-scaffold_310; TARA_SAMEA6039747_MAG_00000027-scaffold_311; TARA_SAMEA6039747_MAG_00000027-scaffold_312; TARA_SAMEA6039747_MAG_00000027-scaffold_313; TARA_SAMEA6039747_MAG_00000027-scaffold_314; TARA_SAMEA6039747_MAG_00000027-scaffold_315; TARA_SAMEA6039747_MAG_00000027-scaffold_316; TARA_SAMEA6039747_MAG_00000027-scaffold_317; TARA_SAMEA6039747_MAG_00000027-scaffold_318; TARA_SAMEA6039747_MAG_00000027-scaffold_319; TARA_SAMEA6039747_MAG_00000027-scaffold_321; TARA_SAMEA6039747_MAG_00000027-scaffold_322; TARA_SAMEA6039747_MAG_00000027-scaffold_323; TARA_SAMEA6039747_MAG_00000027-scaffold_324; TARA_SAMEA6039747_MAG_00000027-scaffold_325; TARA_SAMEA6039747_MAG_00000027-scaffold_327; TARA_SAMEA6039747_MAG_00000027-scaffold_328; TARA_SAMEA6039747_MAG_00000027-scaffold_329; TARA_SAMEA6039747_MAG_00000027-scaffold_330; TARA_SAMEA6039747_MAG_00000027-scaffold_331; TARA_SAMEA6039747_MAG_00000027-scaffold_333; TARA_SAMEA6039747_MAG_00000027-scaffold_334; TARA_SAMEA6039747_MAG_00000027-scaffold_335; TARA_SAMEA6039747_MAG_00000027-scaffold_337; TARA_SAMEA6039747_MAG_00000027-scaffold_339; TARA_SAMEA6039747_MAG_00000027-scaffold_340; TARA_SAMEA6039747_MAG_00000027-scaffold_341; TARA_SAMEA6039747_MAG_00000027-scaffold_342; TARA_SAMEA6039747_MAG_00000027-scaffold_343; TARA_SAMEA6039747_MAG_00000027-scaffold_344; TARA_SAMEA6039747_MAG_00000027-scaffold_345; TARA_SAMEA6039747_MAG_00000027-scaffold_346; TARA_SAMEA6039747_MAG_00000027-scaffold_347; TARA_SAMEA6039747_MAG_00000027-scaffold_348; TARA_SAMEA6039747_MAG_00000027-scaffold_349; TARA_SAMEA6039747_MAG_00000027-scaffold_350; TARA_SAMEA6039747_MAG_00000027-scaffold_351; TARA_SAMEA6039747_MAG_00000027-scaffold_352; TARA_SAMEA6039747_MAG_00000027-scaffold_353; TARA_SAMEA6039747_MAG_00000027-scaffold_354; TARA_SAMEA6039747_MAG_00000027-scaffold_355; TARA_SAMEA6039747_MAG_00000027-scaffold_356; TARA_SAMEA6039747_MAG_00000027-scaffold_357; TARA_SAMEA6039747_MAG_00000027-scaffold_358; TARA_SAMEA6039747_MAG_00000027-scaffold_359; TARA_SAMEA6039747_MAG_00000027-scaffold_360; TARA_SAMEA6039747_MAG_00000027-scaffold_361; TARA_SAMEA6039747_MAG_00000027-scaffold_362; TARA_SAMEA6039747_MAG_00000027-scaffold_363; TARA_SAMEA6039747_MAG_00000027-scaffold_364; TARA_SAMEA6039747_MAG_00000027-scaffold_365; TARA_SAMEA6039747_MAG_00000027-scaffold_366; TARA_SAMEA6039747_MAG_00000027-scaffold_367; TARA_SAMEA6039747_MAG_00000027-scaffold_368; TARA_SAMEA6039747_MAG_00000027-scaffold_369; TARA_SAMEA6039747_MAG_00000027-scaffold_370; TARA_SAMEA6039747_MAG_00000027-scaffold_371; TARA_SAMEA6039747_MAG_00000027-scaffold_372; TARA_SAMEA6039747_MAG_00000027-scaffold_373; TARA_SAMEA6039747_MAG_00000027-scaffold_374; TARA_SAMEA6039747_MAG_00000027-scaffold_375; TARA_SAMEA6039747_MAG_00000027-scaffold_376; TARA_SAMEA6039747_MAG_00000027-scaffold_377; TARA_SAMEA6039747_MAG_00000027-scaffold_378; TARA_SAMEA6039747_MAG_00000027-scaffold_379; TARA_SAMEA6039747_MAG_00000027-scaffold_380; TARA_SAMEA6039747_MAG_00000027-scaffold_381; TARA_SAMEA6039747_MAG_00000027-scaffold_382; TARA_SAMEA6039747_MAG_00000027-scaffold_383; TARA_SAMEA6039747_MAG_00000027-scaffold_384; TARA_SAMEA6039747_MAG_00000027-scaffold_385; TARA_SAMEA6039747_MAG_00000027-scaffold_386; TARA_SAMEA6039747_MAG_00000027-scaffold_387; TARA_SAMEA6039747_MAG_00000027-scaffold_388; TARA_SAMEA6039747_MAG_00000027-scaffold_389; TARA_SAMEA6039747_MAG_00000027-scaffold_390; TARA_SAMEA6039747_MAG_00000027-scaffold_391; TARA_SAMEA6039747_MAG_00000027-scaffold_392; TARA_SAMEA6039747_MAG_00000027-scaffold_393; TARA_SAMEA6039747_MAG_00000027-scaffold_394; TARA_SAMEA6039747_MAG_00000027-scaffold_395; TARA_SAMEA6039747_MAG_00000027-scaffold_396; TARA_SAMEA6039747_MAG_00000027-scaffold_397; TARA_SAMEA6039747_MAG_00000027-scaffold_398; TARA_SAMEA6039747_MAG_00000027-scaffold_399; TARA_SAMEA6039747_MAG_00000027-scaffold_400; TARA_SAMEA6039747_MAG_00000027-scaffold_401; TARA_SAMEA6039747_MAG_00000027-scaffold_402; TARA_SAMEA6039747_MAG_00000027-scaffold_403; TARA_SAMEA6039747_MAG_00000027-scaffold_404; TARA_SAMEA6039747_MAG_00000027-scaffold_405; TARA_SAMEA6039747_MAG_00000027-scaffold_406; TARA_SAMEA6039747_MAG_00000027-scaffold_407; TARA_SAMEA6039747_MAG_00000027-scaffold_408; TARA_SAMEA6039747_MAG_00000027-scaffold_409; TARA_SAMEA6039747_MAG_00000027-scaffold_410; TARA_SAMEA6039747_MAG_00000027-scaffold_411; TARA_SAMEA6039747_MAG_00000027-scaffold_412; TARA_SAMEA6039747_MAG_00000027-scaffold_414; TARA_SAMEA6039747_MAG_00000027-scaffold_415; TARA_SAMEA6039747_MAG_00000027-scaffold_416; TARA_SAMEA6039747_MAG_00000027-scaffold_417; TARA_SAMEA6039747_MAG_00000027-scaffold_418; TARA_SAMEA6039747_MAG_00000027-scaffold_419; TARA_SAMEA6039747_MAG_00000027-scaffold_420; TARA_SAMEA6039747_MAG_00000027-scaffold_421; TARA_SAMEA6039747_MAG_00000027-scaffold_422; TARA_SAMEA6039747_MAG_00000027-scaffold_423; TARA_SAMEA6039747_MAG_00000027-scaffold_424; TARA_SAMEA6039747_MAG_00000027-scaffold_425; TARA_SAMEA6039747_MAG_00000027-scaffold_426; TARA_SAMEA6039747_MAG_00000027-scaffold_427; TARA_SAMEA6039747_MAG_00000027-scaffold_429; TARA_SAMEA6039747_MAG_00000027-scaffold_430; TARA_SAMEA6039747_MAG_00000027-scaffold_431; TARA_SAMEA6039747_MAG_00000027-scaffold_432; TARA_SAMEA6039747_MAG_00000027-scaffold_433; TARA_SAMEA6039747_MAG_00000027-scaffold_434; TARA_SAMEA6039747_MAG_00000027-scaffold_435; TARA_SAMEA6039747_MAG_00000027-scaffold_436; TARA_SAMEA6039747_MAG_00000027-scaffold_437; TARA_SAMEA6039747_MAG_00000027-scaffold_439; TARA_SAMEA6039747_MAG_00000027-scaffold_440; TARA_SAMEA6039747_MAG_00000027-scaffold_441; TARA_SAMEA6039747_MAG_00000027-scaffold_442; TARA_SAMEA6039747_MAG_00000027-scaffold_443; TARA_SAMEA6039747_MAG_00000027-scaffold_444; TARA_SAMEA6039747_MAG_00000027-scaffold_445; TARA_SAMEA6039747_MAG_00000027-scaffold_446; TARA_SAMEA6039747_MAG_00000027-scaffold_447; TARA_SAMEA6039747_MAG_00000027-scaffold_448; TARA_SAMEA6039747_MAG_00000027-scaffold_449; TARA_SAMEA6039747_MAG_00000027-scaffold_450; TARA_SAMEA6039747_MAG_00000027-scaffold_451; TARA_SAMEA6039747_MAG_00000027-scaffold_452; TARA_SAMEA6039747_MAG_00000027-scaffold_453; TARA_SAMEA6039747_MAG_00000027-scaffold_454; TARA_SAMEA6039747_MAG_00000027-scaffold_455; TARA_SAMEA6039747_MAG_00000027-scaffold_456; TARA_SAMEA6039747_MAG_00000027-scaffold_457; TARA_SAMEA6039747_MAG_00000027-scaffold_458; TARA_SAMEA6039747_MAG_00000027-scaffold_459; TARA_SAMEA6039747_MAG_00000027-scaffold_460; TARA_SAMEA6039747_MAG_00000027-scaffold_461; TARA_SAMEA6039747_MAG_00000027-scaffold_462; TARA_SAMEA6039747_MAG_00000027-scaffold_463; TARA_SAMEA6039747_MAG_00000027-scaffold_464; TARA_SAMEA6039747_MAG_00000027-scaffold_466; TARA_SAMEA6039747_MAG_00000027-scaffold_467; TARA_SAMEA6039747_MAG_00000027-scaffold_468; TARA_SAMEA6039747_MAG_00000027-scaffold_469; TARA_SAMEA6039747_MAG_00000027-scaffold_470; TARA_SAMEA6039747_MAG_00000027-scaffold_471; TARA_SAMEA6039747_MAG_00000027-scaffold_472; TARA_SAMEA6039747_MAG_00000027-scaffold_473; TARA_SAMEA6039747_MAG_00000027-scaffold_474; TARA_SAMEA6039747_MAG_00000027-scaffold_475; TARA_SAMEA6039747_MAG_00000027-scaffold_476; TARA_SAMEA6039747_MAG_00000027-scaffold_477; TARA_SAMEA6039747_MAG_00000027-scaffold_478; TARA_SAMEA6039747_MAG_00000027-scaffold_479; TARA_SAMEA6039747_MAG_00000027-scaffold_480; TARA_SAMEA6039747_MAG_00000027-scaffold_481; TARA_SAMEA6039747_MAG_00000027-scaffold_482; TARA_SAMEA6039747_MAG_00000027-scaffold_484; TARA_SAMEA6039747_MAG_00000027-scaffold_485; TARA_SAMEA6039747_MAG_00000027-scaffold_486; TARA_SAMEA6039747_MAG_00000027-scaffold_487; TARA_SAMEA6039747_MAG_00000027-scaffold_488; TARA_SAMEA6039747_MAG_00000027-scaffold_489; TARA_SAMEA6039747_MAG_00000027-scaffold_490; TARA_SAMEA6039747_MAG_00000027-scaffold_491; TARA_SAMEA6039747_MAG_00000027-scaffold_492; TARA_SAMEA6039747_MAG_00000027-scaffold_493; TARA_SAMEA6039747_MAG_00000027-scaffold_494; TARA_SAMEA6039747_MAG_00000027-scaffold_495; TARA_SAMEA6039747_MAG_00000027-scaffold_496; TARA_SAMEA6039747_MAG_00000027-scaffold_497; TARA_SAMEA6039747_MAG_00000027-scaffold_498; TARA_SAMEA6039747_MAG_00000027-scaffold_499; TARA_SAMEA6039747_MAG_00000027-scaffold_500; TARA_SAMEA6039747_MAG_00000027-scaffold_501; TARA_SAMEA6039747_MAG_00000027-scaffold_502; TARA_SAMEA6039747_MAG_00000027-scaffold_503; TARA_SAMEA6039747_MAG_00000027-scaffold_504; TARA_SAMEA6039747_MAG_00000027-scaffold_505; TARA_SAMEA6039747_MAG_00000027-scaffold_506; TARA_SAMEA6039747_MAG_00000027-scaffold_507; TARA_SAMEA6039747_MAG_00000027-scaffold_508; TARA_SAMEA6039747_MAG_00000027-scaffold_509; TARA_SAMEA6039747_MAG_00000027-scaffold_510; TARA_SAMEA6039747_MAG_00000027-scaffold_511; TARA_SAMEA6039747_MAG_00000027-scaffold_512; TARA_SAMEA6039747_MAG_00000027-scaffold_513; TARA_SAMEA6039747_MAG_00000027-scaffold_514; TARA_SAMEA6039747_MAG_00000027-scaffold_515; TARA_SAMEA6039747_MAG_00000027-scaffold_516; TARA_SAMEA6039747_MAG_00000027-scaffold_517; TARA_SAMEA6039747_MAG_00000027-scaffold_518; TARA_SAMEA6039747_MAG_00000027-scaffold_519; TARA_SAMEA6039747_MAG_00000027-scaffold_520; TARA_SAMEA6039747_MAG_00000027-scaffold_521; TARA_SAMEA6039747_MAG_00000027-scaffold_522; TARA_SAMEA6039747_MAG_00000027-scaffold_523; TARA_SAMEA6039747_MAG_00000027-scaffold_524; TARA_SAMEA6039747_MAG_00000027-scaffold_525; TARA_SAMEA6039747_MAG_00000027-scaffold_526; TARA_SAMEA6039747_MAG_00000027-scaffold_527; TARA_SAMEA6039747_MAG_00000027-scaffold_528; TARA_SAMEA6039747_MAG_00000027-scaffold_529; TARA_SAMEA6039747_MAG_00000027-scaffold_530; TARA_SAMEA6039747_MAG_00000027-scaffold_531; TARA_SAMEA6039747_MAG_00000027-scaffold_532; TARA_SAMEA6039747_MAG_00000027-scaffold_533; TARA_SAMEA6039747_MAG_00000027-scaffold_534; TARA_SAMEA6039747_MAG_00000027-scaffold_535; TARA_SAMEA6039747_MAG_00000027-scaffold_536; TARA_SAMEA6039747_MAG_00000027-scaffold_537; TARA_SAMEA6039747_MAG_00000027-scaffold_538; TARA_SAMEA6039747_MAG_00000027-scaffold_539; TARA_SAMEA6039747_MAG_00000027-scaffold_540; TARA_SAMEA6039747_MAG_00000027-scaffold_541; TARA_SAMEA6039747_MAG_00000027-scaffold_542; TARA_SAMEA6039747_MAG_00000027-scaffold_543; TARA_SAMEA6039747_MAG_00000027-scaffold_544; TARA_SAMEA6039747_MAG_00000027-scaffold_545; TARA_SAMEA6039747_MAG_00000027-scaffold_546; TARA_SAMEA6039747_MAG_00000027-scaffold_547; TARA_SAMEA6039747_MAG_00000027-scaffold_548; TARA_SAMEA6039747_MAG_00000027-scaffold_549; TARA_SAMEA6039747_MAG_00000027-scaffold_550; TARA_SAMEA6039747_MAG_00000027-scaffold_551; TARA_SAMEA6039747_MAG_00000027-scaffold_552; TARA_SAMEA6039747_MAG_00000027-scaffold_553; TARA_SAMEA6039747_MAG_00000027-scaffold_554; TARA_SAMEA6039747_MAG_00000027-scaffold_555; TARA_SAMEA6039747_MAG_00000027-scaffold_556; TARA_SAMEA6039747_MAG_00000027-scaffold_558; TARA_SAMEA6039747_MAG_00000027-scaffold_559; TARA_SAMEA6039747_MAG_00000027-scaffold_560; TARA_SAMEA6039747_MAG_00000027-scaffold_561; TARA_SAMEA6039747_MAG_00000027-scaffold_562; TARA_SAMEA6039747_MAG_00000027-scaffold_563; TARA_SAMEA6039747_MAG_00000027-scaffold_564; TARA_SAMEA6039747_MAG_00000027-scaffold_565; TARA_SAMEA6039747_MAG_00000027-scaffold_566; TARA_SAMEA6039747_MAG_00000027-scaffold_567; TARA_SAMEA6039747_MAG_00000027-scaffold_568; TARA_SAMEA6039747_MAG_00000027-scaffold_569; TARA_SAMEA6039747_MAG_00000027-scaffold_570; TARA_SAMEA6039747_MAG_00000027-scaffold_571; TARA_SAMEA6039747_MAG_00000027-scaffold_572; TARA_SAMEA6039747_MAG_00000027-scaffold_573; TARA_SAMEA6039747_MAG_00000027-scaffold_574; TARA_SAMEA6039747_MAG_00000027-scaffold_576; TARA_SAMEA6039747_MAG_00000027-scaffold_577; TARA_SAMEA6039747_MAG_00000027-scaffold_578; TARA_SAMEA6039747_MAG_00000027-scaffold_579; TARA_SAMEA6039747_MAG_00000027-scaffold_580; TARA_SAMEA6039747_MAG_00000027-scaffold_581; TARA_SAMEA6039747_MAG_00000027-scaffold_582; TARA_SAMEA6039747_MAG_00000027-scaffold_583; TARA_SAMEA6039747_MAG_00000027-scaffold_584; TARA_SAMEA6039747_MAG_00000027-scaffold_585; TARA_SAMEA6039747_MAG_00000027-scaffold_586; TARA_SAMEA6039747_MAG_00000027-scaffold_587; TARA_SAMEA6039747_MAG_00000027-scaffold_588; TARA_SAMEA6039747_MAG_00000027-scaffold_589; TARA_SAMEA6039747_MAG_00000027-scaffold_590; TARA_SAMEA6039747_MAG_00000027-scaffold_591; TARA_SAMEA6039747_MAG_00000027-scaffold_592; TARA_SAMEA6039747_MAG_00000027-scaffold_593; TARA_SAMEA6039747_MAG_00000027-scaffold_594; TARA_SAMEA6039747_MAG_00000027-scaffold_595; TARA_SAMEA6039747_MAG_00000027-scaffold_596; TARA_SAMEA6039747_MAG_00000027-scaffold_597; TARA_SAMEA6039747_MAG_00000027-scaffold_598; TARA_SAMEA6039747_MAG_00000027-scaffold_599; TARA_SAMEA6039747_MAG_00000027-scaffold_600; TARA_SAMEA6039747_MAG_00000027-scaffold_601; TARA_SAMEA6039747_MAG_00000027-scaffold_603; TARA_SAMEA6039747_MAG_00000027-scaffold_604; TARA_SAMEA6039747_MAG_00000027-scaffold_605; TARA_SAMEA6039747_MAG_00000027-scaffold_606; TARA_SAMEA6039747_MAG_00000027-scaffold_607; TARA_SAMEA6039747_MAG_00000027-scaffold_608; TARA_SAMEA6039747_MAG_00000027-scaffold_609; TARA_SAMEA6039747_MAG_00000027-scaffold_610; TARA_SAMEA6039747_MAG_00000027-scaffold_611; TARA_SAMEA6039747_MAG_00000027-scaffold_612; TARA_SAMEA6039747_MAG_00000027-scaffold_613; TARA_SAMEA6039747_MAG_00000027-scaffold_614; TARA_SAMEA6039747_MAG_00000027-scaffold_615; TARA_SAMEA6039747_MAG_00000027-scaffold_616; TARA_SAMEA6039747_MAG_00000027-scaffold_617; TARA_SAMEA6039747_MAG_00000027-scaffold_618; TARA_SAMEA6039747_MAG_00000027-scaffold_619; TARA_SAMEA6039747_MAG_00000027-scaffold_620; TARA_SAMEA6039747_MAG_00000027-scaffold_621; TARA_SAMEA6039747_MAG_00000027-scaffold_622; TARA_SAMEA6039747_MAG_00000027-scaffold_623; TARA_SAMEA6039747_MAG_00000027-scaffold_624; TARA_SAMEA6039747_MAG_00000027-scaffold_625; TARA_SAMEA6039747_MAG_00000027-scaffold_626; TARA_SAMEA6039747_MAG_00000027-scaffold_627; TARA_SAMEA6039747_MAG_00000027-scaffold_628; TARA_SAMEA6039747_MAG_00000027-scaffold_629; TARA_SAMEA6039747_MAG_00000027-scaffold_630; TARA_SAMEA6039747_MAG_00000027-scaffold_631; TARA_SAMEA6039747_MAG_00000027-scaffold_632; TARA_SAMEA6039747_MAG_00000027-scaffold_633; TARA_SAMEA6039747_MAG_00000027-scaffold_634; TARA_SAMEA6039747_MAG_00000027-scaffold_635; TARA_SAMEA6039747_MAG_00000027-scaffold_637; TARA_SAMEA6039747_MAG_00000027-scaffold_638; TARA_SAMEA6039747_MAG_00000027-scaffold_639; TARA_SAMEA6039747_MAG_00000027-scaffold_640; TARA_SAMEA6039747_MAG_00000027-scaffold_641; TARA_SAMEA6039747_MAG_00000027-scaffold_642; TARA_SAMEA6039747_MAG_00000027-scaffold_643; TARA_SAMEA6039747_MAG_00000027-scaffold_644; TARA_SAMEA6039747_MAG_00000027-scaffold_645; TARA_SAMEA6039747_MAG_00000027-scaffold_646; TARA_SAMEA6039747_MAG_00000027-scaffold_647; TARA_SAMEA6039747_MAG_00000027-scaffold_648; TARA_SAMEA6039747_MAG_00000027-scaffold_649; TARA_SAMEA6039747_MAG_00000027-scaffold_650; TARA_SAMEA6039747_MAG_00000027-scaffold_651; TARA_SAMEA6039747_MAG_00000027-scaffold_652; TARA_SAMEA6039747_MAG_00000027-scaffold_653; TARA_SAMEA6039747_MAG_00000027-scaffold_654; TARA_SAMEA6039747_MAG_00000027-scaffold_655; TARA_SAMEA6039747_MAG_00000027-scaffold_656; TARA_SAMEA6039747_MAG_00000027-scaffold_657; TARA_SAMEA6039747_MAG_00000027-scaffold_658; TARA_SAMEA6039747_MAG_00000027-scaffold_660; TARA_SAMEA6039747_MAG_00000027-scaffold_661; TARA_SAMEA6039747_MAG_00000027-scaffold_662; TARA_SAMEA6039747_MAG_00000027-scaffold_663; TARA_SAMEA6039747_MAG_00000027-scaffold_664; TARA_SAMEA6039747_MAG_00000027-scaffold_665; TARA_SAMEA6039747_MAG_00000027-scaffold_666; TARA_SAMEA6039747_MAG_00000027-scaffold_667; TARA_SAMEA6039747_MAG_00000027-scaffold_668; TARA_SAMEA6039747_MAG_00000027-scaffold_669; TARA_SAMEA6039747_MAG_00000027-scaffold_670; TARA_SAMEA6039747_MAG_00000027-scaffold_671; TARA_SAMEA6039747_MAG_00000027-scaffold_672; TARA_SAMEA6039747_MAG_00000027-scaffold_674; TARA_SAMEA6039747_MAG_00000027-scaffold_675; TARA_SAMEA6039747_MAG_00000027-scaffold_677; TARA_SAMEA6039747_MAG_00000027-scaffold_678; TARA_SAMEA6039747_MAG_00000027-scaffold_680; TARA_SAMEA6039747_MAG_00000027-scaffold_681; TARA_SAMEA6039747_MAG_00000027-scaffold_682; TARA_SAMEA6039747_MAG_00000027-scaffold_683; TARA_SAMEA6039747_MAG_00000027-scaffold_684; TARA_SAMEA6039747_MAG_00000027-scaffold_685; TARA_SAMEA6039747_MAG_00000027-scaffold_686; TARA_SAMEA6039747_MAG_00000027-scaffold_687; TARA_SAMEA6039747_MAG_00000027-scaffold_688; TARA_SAMEA6039747_MAG_00000027-scaffold_689; TARA_SAMEA6039747_MAG_00000027-scaffold_690; TARA_SAMEA6039747_MAG_00000027-scaffold_691; TARA_SAMEA6039747_MAG_00000027-scaffold_692; TARA_SAMEA6039747_MAG_00000027-scaffold_693; TARA_SAMEA6039747_MAG_00000027-scaffold_694; TARA_SAMEA6039747_MAG_00000027-scaffold_695; TARA_SAMEA6039747_MAG_00000027-scaffold_696; TARA_SAMEA6039747_MAG_00000027-scaffold_697; TARA_SAMEA6039747_MAG_00000027-scaffold_698; TARA_SAMEA6039747_MAG_00000027-scaffold_699; TARA_SAMEA6039747_MAG_00000027-scaffold_700; TARA_SAMEA6039747_MAG_00000027-scaffold_701; TARA_SAMEA6039747_MAG_00000027-scaffold_702; TARA_SAMEA6039747_MAG_00000027-scaffold_703; TARA_SAMEA6039747_MAG_00000027-scaffold_704; TARA_SAMEA6039747_MAG_00000027-scaffold_705; TARA_SAMEA6039747_MAG_00000027-scaffold_706; TARA_SAMEA6039747_MAG_00000027-scaffold_707; TARA_SAMEA6039747_MAG_00000027-scaffold_708; TARA_SAMEA6039747_MAG_00000027-scaffold_709; TARA_SAMEA6039747_MAG_00000027-scaffold_710; TARA_SAMEA6039747_MAG_00000027-scaffold_711; TARA_SAMEA6039747_MAG_00000027-scaffold_712; TARA_SAMEA6039747_MAG_00000027-scaffold_714; TARA_SAMEA6039747_MAG_00000027-scaffold_715; TARA_SAMEA6039747_MAG_00000027-scaffold_716; TARA_SAMEA6039747_MAG_00000027-scaffold_717; TARA_SAMEA6039747_MAG_00000027-scaffold_718; TARA_SAMEA6039747_MAG_00000027-scaffold_719; TARA_SAMEA6039747_MAG_00000027-scaffold_720; TARA_SAMEA6039747_MAG_00000027-scaffold_721; TARA_SAMEA6039747_MAG_00000027-scaffold_722; TARA_SAMEA6039747_MAG_00000027-scaffold_723; TARA_SAMEA6039747_MAG_00000027-scaffold_724; TARA_SAMEA6039747_MAG_00000027-scaffold_725; TARA_SAMEA6039747_MAG_00000027-scaffold_727; TARA_SAMEA6039747_MAG_00000027-scaffold_728; TARA_SAMEA6039747_MAG_00000027-scaffold_729; TARA_SAMEA6039747_MAG_00000027-scaffold_730; TARA_SAMEA6039747_MAG_00000027-scaffold_731; TARA_SAMEA6039747_MAG_00000027-scaffold_732; TARA_SAMEA6039747_MAG_00000027-scaffold_733; TARA_SAMEA6039747_MAG_00000027-scaffold_734; TARA_SAMEA6039747_MAG_00000027-scaffold_735; TARA_SAMEA6039747_MAG_00000027-scaffold_736; TARA_SAMEA6039747_MAG_00000027-scaffold_737; TARA_SAMEA6039747_MAG_00000027-scaffold_738; TARA_SAMEA6039747_MAG_00000027-scaffold_739; TARA_SAMEA6039747_MAG_00000027-scaffold_740; TARA_SAMEA6039747_MAG_00000027-scaffold_741; TARA_SAMEA6039747_MAG_00000027-scaffold_742; TARA_SAMEA6039747_MAG_00000027-scaffold_743; TARA_SAMEA6039747_MAG_00000027-scaffold_744; TARA_SAMEA6039747_MAG_00000027-scaffold_745; TARA_SAMEA6039747_MAG_00000027-scaffold_746; TARA_SAMEA6039747_MAG_00000027-scaffold_747; TARA_SAMEA6039747_MAG_00000027-scaffold_748; TARA_SAMEA6039747_MAG_00000027-scaffold_749; TARA_SAMEA6039747_MAG_00000027-scaffold_750; TARA_SAMEA6039747_MAG_00000027-scaffold_751; TARA_SAMEA6039747_MAG_00000027-scaffold_752; TARA_SAMEA6039747_MAG_00000027-scaffold_753; TARA_SAMEA6039747_MAG_00000027-scaffold_754; TARA_SAMEA6039747_MAG_00000027-scaffold_755; TARA_SAMEA6039747_MAG_00000027-scaffold_756; TARA_SAMEA6039747_MAG_00000027-scaffold_757; TARA_SAMEA6039747_MAG_00000027-scaffold_758; TARA_SAMEA6039747_MAG_00000027-scaffold_759; TARA_SAMEA6039747_MAG_00000027-scaffold_760; TARA_SAMEA6039747_MAG_00000027-scaffold_761; TARA_SAMEA6039747_MAG_00000027-scaffold_762; TARA_SAMEA6039747_MAG_00000027-scaffold_763; TARA_SAMEA6039747_MAG_00000027-scaffold_764; TARA_SAMEA6039747_MAG_00000027-scaffold_765; TARA_SAMEA6039747_MAG_00000027-scaffold_766; TARA_SAMEA6039747_MAG_00000027-scaffold_767; TARA_SAMEA6039747_MAG_00000027-scaffold_768; TARA_SAMEA6039747_MAG_00000027-scaffold_769; TARA_SAMEA6039747_MAG_00000027-scaffold_770; TARA_SAMEA6039747_MAG_00000027-scaffold_771; TARA_SAMEA6039747_MAG_00000027-scaffold_772; TARA_SAMEA6039747_MAG_00000027-scaffold_773; TARA_SAMEA6039747_MAG_00000027-scaffold_774; TARA_SAMEA6039747_MAG_00000027-scaffold_775; TARA_SAMEA6039747_MAG_00000027-scaffold_776; TARA_SAMEA6039747_MAG_00000027-scaffold_777; TARA_SAMEA6039747_MAG_00000027-scaffold_778; TARA_SAMEA6039747_MAG_00000027-scaffold_779; TARA_SAMEA6039747_MAG_00000027-scaffold_780; TARA_SAMEA6039747_MAG_00000027-scaffold_781; TARA_SAMEA6039747_MAG_00000027-scaffold_782; TARA_SAMEA6039747_MAG_00000027-scaffold_783; TARA_SAMEA6039747_MAG_00000027-scaffold_784; TARA_SAMEA6039747_MAG_00000027-scaffold_785; TARA_SAMEA6039747_MAG_00000027-scaffold_786; TARA_SAMEA6039747_MAG_00000027-scaffold_787; TARA_SAMEA6039747_MAG_00000027-scaffold_788; TARA_SAMEA6039747_MAG_00000027-scaffold_789; TARA_SAMEA6039747_MAG_00000027-scaffold_790; TARA_SAMEA6039747_MAG_00000027-scaffold_791; TARA_SAMEA6039747_MAG_00000027-scaffold_792; TARA_SAMEA6039747_MAG_00000027-scaffold_793; TARA_SAMEA6039747_MAG_00000027-scaffold_794; TARA_SAMEA6039747_MAG_00000027-scaffold_795; TARA_SAMEA6039747_MAG_00000027-scaffold_796; TARA_SAMEA6039747_MAG_00000027-scaffold_797; TARA_SAMEA6039747_MAG_00000027-scaffold_798; TARA_SAMEA6039747_MAG_00000027-scaffold_799; TARA_SAMEA6039747_MAG_00000027-scaffold_800; TARA_SAMEA6039747_MAG_00000027-scaffold_801; TARA_SAMEA6039747_MAG_00000027-scaffold_802; TARA_SAMEA6039747_MAG_00000027-scaffold_803; TARA_SAMEA6039747_MAG_00000027-scaffold_804; TARA_SAMEA6039747_MAG_00000027-scaffold_805; TARA_SAMEA6039747_MAG_00000027-scaffold_806; TARA_SAMEA6039747_MAG_00000027-scaffold_807; TARA_SAMEA6039747_MAG_00000027-scaffold_808; TARA_SAMEA6039747_MAG_00000027-scaffold_810; TARA_SAMEA6039747_MAG_00000027-scaffold_811; TARA_SAMEA6039747_MAG_00000027-scaffold_812; TARA_SAMEA6039747_MAG_00000027-scaffold_813; TARA_SAMEA6039747_MAG_00000027-scaffold_814; TARA_SAMEA6039747_MAG_00000027-scaffold_815; TARA_SAMEA6039747_MAG_00000027-scaffold_816; TARA_SAMEA6039747_MAG_00000027-scaffold_817; TARA_SAMEA6039747_MAG_00000027-scaffold_818; TARA_SAMEA6039747_MAG_00000027-scaffold_819; TARA_SAMEA6039747_MAG_00000027-scaffold_820; TARA_SAMEA6039747_MAG_00000027-scaffold_821; TARA_SAMEA6039747_MAG_00000027-scaffold_822; TARA_SAMEA6039747_MAG_00000027-scaffold_823; TARA_SAMEA6039747_MAG_00000027-scaffold_824; TARA_SAMEA6039747_MAG_00000027-scaffold_825; TARA_SAMEA6039747_MAG_00000027-scaffold_826; TARA_SAMEA6039747_MAG_00000027-scaffold_827; TARA_SAMEA6039747_MAG_00000027-scaffold_828; TARA_SAMEA6039747_MAG_00000027-scaffold_829; TARA_SAMEA6039747_MAG_00000027-scaffold_830; TARA_SAMEA6039747_MAG_00000027-scaffold_831; TARA_SAMEA6039747_MAG_00000027-scaffold_832; TARA_SAMEA6039747_MAG_00000027-scaffold_833; TARA_SAMEA6039747_MAG_00000027-scaffold_834; TARA_SAMEA6039747_MAG_00000027-scaffold_835; TARA_SAMEA6039747_MAG_00000027-scaffold_836; TARA_SAMEA6039747_MAG_00000027-scaffold_837; TARA_SAMEA6039747_MAG_00000027-scaffold_838; TARA_SAMEA6039747_MAG_00000027-scaffold_839; TARA_SAMEA6039747_MAG_00000027-scaffold_840; TARA_SAMEA6039747_MAG_00000027-scaffold_841; TARA_SAMEA6039747_MAG_00000027-scaffold_842; TARA_SAMEA6039747_MAG_00000027-scaffold_843; TARA_SAMEA6039747_MAG_00000027-scaffold_844; TARA_SAMEA6039747_MAG_00000027-scaffold_845; TARA_SAMEA6039747_MAG_00000027-scaffold_846; TARA_SAMEA6039747_MAG_00000027-scaffold_847; TARA_SAMEA6039747_MAG_00000027-scaffold_848; TARA_SAMEA6039747_MAG_00000027-scaffold_849; TARA_SAMEA6039747_MAG_00000027-scaffold_850; TARA_SAMEA6039747_MAG_00000027-scaffold_851; TARA_SAMEA6039747_MAG_00000027-scaffold_852; TARA_SAMEA6039747_MAG_00000027-scaffold_853; TARA_SAMEA6039747_MAG_00000027-scaffold_854; TARA_SAMEA6039747_MAG_00000027-scaffold_855; TARA_SAMEA6039747_MAG_00000027-scaffold_856; TARA_SAMEA6039747_MAG_00000027-scaffold_857; TARA_SAMEA6039747_MAG_00000027-scaffold_858; TARA_SAMEA6039747_MAG_00000027-scaffold_859; TARA_SAMEA6039747_MAG_00000027-scaffold_860; TARA_SAMEA6039747_MAG_00000027-scaffold_861; TARA_SAMEA6039747_MAG_00000027-scaffold_862; TARA_SAMEA6039747_MAG_00000027-scaffold_863; TARA_SAMEA6039747_MAG_00000027-scaffold_865; TARA_SAMEA6039747_MAG_00000027-scaffold_866; TARA_SAMEA6039747_MAG_00000027-scaffold_867; TARA_SAMEA6039747_MAG_00000027-scaffold_868; TARA_SAMEA6039747_MAG_00000027-scaffold_870; TARA_SAMEA6039747_MAG_00000027-scaffold_871; TARA_SAMEA6039747_MAG_00000027-scaffold_872; TARA_SAMEA6039747_MAG_00000027-scaffold_873; TARA_SAMEA6039747_MAG_00000027-scaffold_874; TARA_SAMEA6039747_MAG_00000027-scaffold_875; TARA_SAMEA6039747_MAG_00000027-scaffold_876; TARA_SAMEA6039747_MAG_00000027-scaffold_877; TARA_SAMEA6039747_MAG_00000027-scaffold_878; TARA_SAMEA6039747_MAG_00000027-scaffold_879; TARA_SAMEA6039747_MAG_00000027-scaffold_880; TARA_SAMEA6039747_MAG_00000027-scaffold_881; TARA_SAMEA6039747_MAG_00000027-scaffold_882; TARA_SAMEA6039747_MAG_00000027-scaffold_883; TARA_SAMEA6039747_MAG_00000027-scaffold_884; TARA_SAMEA6039747_MAG_00000027-scaffold_885; TARA_SAMEA6039747_MAG_00000027-scaffold_887; TARA_SAMEA6039747_MAG_00000027-scaffold_888; TARA_SAMEA6039747_MAG_00000027-scaffold_889; TARA_SAMEA6039747_MAG_00000027-scaffold_890; TARA_SAMEA6039747_MAG_00000027-scaffold_891; TARA_SAMEA6039747_MAG_00000027-scaffold_892; TARA_SAMEA6039747_MAG_00000027-scaffold_893; TARA_SAMEA6039747_MAG_00000027-scaffold_894; TARA_SAMEA6039747_MAG_00000027-scaffold_895; TARA_SAMEA6039747_MAG_00000027-scaffold_896; TARA_SAMEA6039747_MAG_00000027-scaffold_897; TARA_SAMEA6039747_MAG_00000027-scaffold_898; TARA_SAMEA6039747_MAG_00000027-scaffold_899; TARA_SAMEA6039747_MAG_00000027-scaffold_900; TARA_SAMEA6039747_MAG_00000027-scaffold_901; TARA_SAMEA6039747_MAG_00000027-scaffold_902; TARA_SAMEA6039747_MAG_00000027-scaffold_903; TARA_SAMEA6039747_MAG_00000027-scaffold_904; TARA_SAMEA6039747_MAG_00000027-scaffold_905; TARA_SAMEA6039747_MAG_00000027-scaffold_906; TARA_SAMEA6039747_MAG_00000027-scaffold_907; TARA_SAMEA6039747_MAG_00000027-scaffold_908; TARA_SAMEA6039747_MAG_00000027-scaffold_909; TARA_SAMEA6039747_MAG_00000027-scaffold_910; TARA_SAMEA6039747_MAG_00000027-scaffold_911; TARA_SAMEA6039747_MAG_00000027-scaffold_912; TARA_SAMEA6039747_MAG_00000027-scaffold_913; TARA_SAMEA6039747_MAG_00000027-scaffold_914; TARA_SAMEA6039747_MAG_00000027-scaffold_915; TARA_SAMEA6039747_MAG_00000027-scaffold_916; TARA_SAMEA6039747_MAG_00000027-scaffold_917; TARA_SAMEA6039747_MAG_00000027-scaffold_918; TARA_SAMEA6039747_MAG_00000027-scaffold_919; TARA_SAMEA6039747_MAG_00000027-scaffold_920; TARA_SAMEA6039747_MAG_00000027-scaffold_921; TARA_SAMEA6039747_MAG_00000027-scaffold_922; TARA_SAMEA6039747_MAG_00000027-scaffold_923; TARA_SAMEA6039747_MAG_00000027-scaffold_924; TARA_SAMEA6039747_MAG_00000027-scaffold_925; TARA_SAMEA6039747_MAG_00000027-scaffold_926; TARA_SAMEA6039747_MAG_00000027-scaffold_927; TARA_SAMEA6039747_MAG_00000027-scaffold_928; TARA_SAMEA6039747_MAG_00000027-scaffold_929; TARA_SAMEA6039747_MAG_00000027-scaffold_930; TARA_SAMEA6039747_MAG_00000027-scaffold_931; TARA_SAMEA6039747_MAG_00000027-scaffold_932; TARA_SAMEA6039747_MAG_00000027-scaffold_933; TARA_SAMEA6039747_MAG_00000027-scaffold_934; TARA_SAMEA6039747_MAG_00000027-scaffold_935; TARA_SAMEA6039747_MAG_00000027-scaffold_936; TARA_SAMEA6039747_MAG_00000027-scaffold_938; TARA_SAMEA6039747_MAG_00000027-scaffold_939; TARA_SAMEA6039747_MAG_00000027-scaffold_940; TARA_SAMEA6039747_MAG_00000027-scaffold_941; TARA_SAMEA6039747_MAG_00000027-scaffold_942; TARA_SAMEA6039747_MAG_00000027-scaffold_943; TARA_SAMEA6039747_MAG_00000027-scaffold_944; TARA_SAMEA6039747_MAG_00000027-scaffold_945; TARA_SAMEA6039747_MAG_00000027-scaffold_946; TARA_SAMEA6039747_MAG_00000027-scaffold_947; TARA_SAMEA6039747_MAG_00000027-scaffold_948; TARA_SAMEA6039747_MAG_00000027-scaffold_949; TARA_SAMEA6039747_MAG_00000027-scaffold_950; TARA_SAMEA6039747_MAG_00000027-scaffold_951; TARA_SAMEA6039747_MAG_00000027-scaffold_952; TARA_SAMEA6039747_MAG_00000027-scaffold_953; TARA_SAMEA6039747_MAG_00000027-scaffold_954; TARA_SAMEA6039747_MAG_00000027-scaffold_955; TARA_SAMEA6039747_MAG_00000027-scaffold_956; TARA_SAMEA6039747_MAG_00000027-scaffold_957; TARA_SAMEA6039747_MAG_00000027-scaffold_958; TARA_SAMEA6039747_MAG_00000027-scaffold_959; TARA_SAMEA6039747_MAG_00000027-scaffold_960; TARA_SAMEA6039747_MAG_00000027-scaffold_961; TARA_SAMEA6039747_MAG_00000027-scaffold_962; TARA_SAMEA6039747_MAG_00000027-scaffold_963; TARA_SAMEA6039747_MAG_00000027-scaffold_964; TARA_SAMEA6039747_MAG_00000027-scaffold_965; TARA_SAMEA6039747_MAG_00000027-scaffold_966; TARA_SAMEA6039747_MAG_00000027-scaffold_967; TARA_SAMEA6039747_MAG_00000027-scaffold_969

Compact view

TARA_SAMEA6039747_MAG_00000027-scaffold_2 - Region 1 - hglE-KS

Download region GenBank file

Download region SVG

Location: 1 - 33,080 nt. (total: 33,080 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6039747_MAG_00000027-scaffold_11 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 32,974 nt. (total: 32,974 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 32974:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_11_4

Search NORINE for peptide: strict or relaxed

AMP-binding (9..429): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmFYLGsqCK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_11_6

Search NORINE for peptide: strict or relaxed

AMP-binding (512..925): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_11_11

Search NORINE for peptide: strict or relaxed

AMP-binding (527..934): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSaLiAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_18 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 28,459 nt. (total: 28,459 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6039747_MAG_00000027-scaffold_21 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 26,070 nt. (total: 26,070 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 26070:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_21_5

Search NORINE for peptide: strict or relaxed

AMP-binding (9..426): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: eqvvaGGPvK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 40% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_26 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 25,254 nt. (total: 25,254 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25254:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (tyr) + (ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_26_2

Search NORINE for peptide: strict or relaxed

AMP-binding (516..928): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVrHFaLlaK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_26_3

PKS_AT (538..911): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 124.3
Methoxymalonyl-CoA: 96.5
Methylmalonyl-CoA: 67.7
inactive: 65.1
Isobutyryl-CoA: 55.6
Ethylmalonyl-CoA: 41.2
Propionyl-CoA: 29.5
CHC-CoA: 26.5
2-Methylbutyryl-CoA: 25.1
Acetyl-CoA: 24.5
Benzoyl-CoA: 23.6
fatty_acid: 22.9
trans-1,2-CPDA: 19.6
3-Methylbutyryl-CoA: 10.5

TARA_SAMEA6039747_MAG_00000027-scaffold_26_6

Search NORINE for peptide: strict or relaxed

AMP-binding (502..908): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_26_7

Search NORINE for peptide: strict or relaxed

AMP-binding (482..896): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWQvttdDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_29 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 23,272 nt. (total: 23,272 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 23272:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_29_1

Search NORINE for peptide: strict or relaxed

CAL_domain (39..476): pk

minowa: NH2

Prediction, score:

NH2: 179.0
fatty_acid: 19.8
AHBA: 18.2
shikimic_acid: 0.0
Acetyl-CoA: -0.4

AMP-binding (1214..1626): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_32 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 15,726 nt. (total: 15,726 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6039747_MAG_00000027-scaffold_34 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 14,384 nt. (total: 14,384 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_52 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 19,805 nt. (total: 19,805 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 19805:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_52_1

Search NORINE for peptide: strict or relaxed

PKS_AT (387..683): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 168.4
inactive: 108.4
Methoxymalonyl-CoA: 75.3
Methylmalonyl-CoA: 67.5
Propionyl-CoA: 54.8
Ethylmalonyl-CoA: 39.4
CHC-CoA: 29.9
2-Methylbutyryl-CoA: 28.0
fatty_acid: 27.9
Isobutyryl-CoA: 26.8
Benzoyl-CoA: 23.4
Acetyl-CoA: 18.2
trans-1,2-CPDA: 15.8
3-Methylbutyryl-CoA: 11.3

AMP-binding (1353..1754): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNmSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6039747_MAG_00000027-scaffold_52_4

Search NORINE for peptide: strict or relaxed

AMP-binding (27..405): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AteAaGlVfK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_64 - Region 1 - ladderane

Download region GenBank file

Download region SVG

Location: 1 - 18,747 nt. (total: 18,747 nt) Show pHMM detection rules used

Region on contig edge.

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_67 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 4,903 - 18,482 nt. (total: 13,580 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6039747_MAG_00000027-scaffold_79 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 17,711 nt. (total: 17,711 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 17711:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (cys - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_79_2

Search NORINE for peptide: strict or relaxed

AMP-binding (492..906): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DmTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (1591..1989): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWlGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6039747_MAG_00000027-scaffold_79_3

Search NORINE for peptide: strict or relaxed

AMP-binding (454..861): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLydFSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1543..1955): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWqIGfVsK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (2634..3036): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvhdwAAVYK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_86 - Region 1 - T1PKS,amglyccycl

Download region GenBank file

Download region SVG

Location: 1 - 17,240 nt. (total: 17,240 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
amglyccycl: (strH or strK1 or strK2 or NeoL or DOIS or ValA or SpcFG or SpcDK_glyc or salQ)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 17240:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_86_4

PKS_AT (573..814): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 49.5
inactive: 43.1
Methylmalonyl-CoA: 17.1
Methoxymalonyl-CoA: 16.7
Isobutyryl-CoA: 14.9
Benzoyl-CoA: 14.9
trans-1,2-CPDA: 9.8
Propionyl-CoA: 9.5
fatty_acid: 9.4
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TARA_SAMEA6039747_MAG_00000027-scaffold_91 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 17,069 nt. (total: 17,069 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 17069:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala) + (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_91_9

Search NORINE for peptide: strict or relaxed

AMP-binding (834..1248): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6039747_MAG_00000027-scaffold_91_10

Search NORINE for peptide: strict or relaxed

AMP-binding (882..1136): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLwN-----K
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 40% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_94 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 17,030 nt. (total: 17,030 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 17030:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_94_3

Search NORINE for peptide: strict or relaxed

AMP-binding (485..920): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_94_4

CAL_domain (39..485): pk

minowa: NH2

Prediction, score:

NH2: 174.9
AHBA: 25.3
fatty_acid: 20.9
shikimic_acid: 3.8
Acetyl-CoA: 1.5

TARA_SAMEA6039747_MAG_00000027-scaffold_105 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 16,318 nt. (total: 16,318 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 16318:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_105_2

PKS_AT (528..809): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 121.5
inactive: 79.4
Methoxymalonyl-CoA: 72.1
Methylmalonyl-CoA: 56.8
Ethylmalonyl-CoA: 30.5
Propionyl-CoA: 30.0
Benzoyl-CoA: 20.1
Isobutyryl-CoA: 19.0
Acetyl-CoA: 18.5
2-Methylbutyryl-CoA: 17.5
CHC-CoA: 16.8
trans-1,2-CPDA: 9.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

TARA_SAMEA6039747_MAG_00000027-scaffold_131 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 15,182 nt. (total: 15,182 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6039747_MAG_00000027-scaffold_144 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 14,690 nt. (total: 14,690 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 14690:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asp - ser - gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_144_1

Search NORINE for peptide: strict or relaxed

AMP-binding (553..963): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLsKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

AMP-binding (1622..2029): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2689..3088): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_145 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 14,670 nt. (total: 14,670 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 14670:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_145_2

Search NORINE for peptide: strict or relaxed

AMP-binding (545..957): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenVGAIgK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_145_3

Search NORINE for peptide: strict or relaxed

AMP-binding (528..935): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_183 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 13,475 nt. (total: 13,475 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13475:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - D-ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_183_1

Search NORINE for peptide: strict or relaxed

PKS_AT (536..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 157.3
inactive: 79.0
Methoxymalonyl-CoA: 73.6
Methylmalonyl-CoA: 67.2
Ethylmalonyl-CoA: 43.9
Propionyl-CoA: 40.8
fatty_acid: 22.1
2-Methylbutyryl-CoA: 21.9
Benzoyl-CoA: 21.5
trans-1,2-CPDA: 21.2
CHC-CoA: 19.7
Acetyl-CoA: 18.9
Isobutyryl-CoA: 13.9
3-Methylbutyryl-CoA: 0.0

AMP-binding (2027..2433): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_226 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 12,235 nt. (total: 12,235 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 12235:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_226_1

Search NORINE for peptide: strict or relaxed

AMP-binding (93..497): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1758..2096): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPcqyGVirK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_226_2

Search NORINE for peptide: strict or relaxed

AMP-binding (776..1173): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPcqyGVirK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_229 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 12,181 nt. (total: 12,181 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_259 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 1 - 11,504 nt. (total: 11,504 nt) Show pHMM detection rules used

Region on contig edge.

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_271 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 11,275 nt. (total: 11,275 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 11275:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_271_1

Search NORINE for peptide: strict or relaxed

AMP-binding (3..368): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DmYnfGVLWK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_271_2

PKS_AT (535..836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.0
inactive: 79.1
Methoxymalonyl-CoA: 74.0
Methylmalonyl-CoA: 69.0
Ethylmalonyl-CoA: 60.2
2-Methylbutyryl-CoA: 57.0
Propionyl-CoA: 53.9
Isobutyryl-CoA: 42.5
Benzoyl-CoA: 35.8
fatty_acid: 26.7
3-Methylbutyryl-CoA: 26.2
Acetyl-CoA: 24.7
trans-1,2-CPDA: 22.9
CHC-CoA: 20.4

TARA_SAMEA6039747_MAG_00000027-scaffold_276 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 11,210 nt. (total: 11,210 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_277 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 1,116 - 11,209 nt. (total: 10,094 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_278 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 11,201 nt. (total: 11,201 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6039747_MAG_00000027-scaffold_283 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 11,025 nt. (total: 11,025 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 11025:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_283_1

PKS_AT (507..803): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 79.2%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 179.1
Ethylmalonyl-CoA: 160.2
Methoxymalonyl-CoA: 135.7
Isobutyryl-CoA: 117.0
2-Methylbutyryl-CoA: 110.1
Malonyl-CoA: 104.5
Benzoyl-CoA: 101.2
Acetyl-CoA: 86.4
Propionyl-CoA: 85.6
trans-1,2-CPDA: 82.6
CHC-CoA: 57.7
3-Methylbutyryl-CoA: 42.1
fatty_acid: 39.8
inactive: 36.5

TARA_SAMEA6039747_MAG_00000027-scaffold_286 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,979 nt. (total: 10,979 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10979:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_286_5

Search NORINE for peptide: strict or relaxed

AMP-binding (641..1034): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (1695..2095): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAfTtAlIwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_288 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 10,961 nt. (total: 10,961 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptides - No core peptides found.

Lasso peptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6039747_MAG_00000027-scaffold_293 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,926 nt. (total: 10,926 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10926:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_293_1

Search NORINE for peptide: strict or relaxed

AMP-binding (1..247): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenIGAVtK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_293_2

Search NORINE for peptide: strict or relaxed

AMP-binding (459..865): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6039747_MAG_00000027-scaffold_306 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,633 nt. (total: 10,633 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10633:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-ser) + (D-gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_306_3

Search NORINE for peptide: strict or relaxed

AMP-binding (110..520): gln

NRPSPredictor2: gln

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWgFGvIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6039747_MAG_00000027-scaffold_306_4

Search NORINE for peptide: strict or relaxed

AMP-binding (93..496): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_320 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,385 nt. (total: 10,385 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10385:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_320_2

Search NORINE for peptide: strict or relaxed

AMP-binding (709..1112): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenVGAIgK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_326 - Region 1 - LAP,siderophore

Download region GenBank file

Download region SVG

Location: 1 - 10,328 nt. (total: 10,328 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)
siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_332 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 10,250 nt. (total: 10,250 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for TARA_SAMEA6039747_MAG_00000027-scaffold_332_4 - Putative Class I

TARA_SAMEA6039747_MAG_00000027-scaffold_332_3 leader / core peptide: MKKRPMNAKLRLRKDTVQALDQNSMSKAR - GGGFDhbDAGDhbVCDQLDhbLDhaPHCALDhaCDDhbCGCNPGPDhaFAGCDhbDhaIGCDhbVPHC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_332_3 - Class I

Cleavage pHMM score: -11.20

RODEO score: 20

Monoisotopic mass: 4479.9 Da

Molecular weight: 4483.0 Da

Number of bridges: 8

Alternative weights: (assuming N unmodified Ser/Thr residues); 4501.0 Da N = 1; 4519.0 Da N = 2

TARA_SAMEA6039747_MAG_00000027-scaffold_336 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 10,070 nt. (total: 10,070 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10070:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_336_2

Search NORINE for peptide: strict or relaxed

AMP-binding (39..438): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vhSSrGAniK
Nearest Stachelhaus code:: trp
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_338 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,060 nt. (total: 10,060 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10060:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_338_5

Search NORINE for peptide: strict or relaxed

AMP-binding (0..241): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (910..1340): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgcHevLLaK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6039747_MAG_00000027-scaffold_413 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 9,104 nt. (total: 9,104 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9104:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_413_5

PKS_AT (264..559): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.1
inactive: 75.1
Methylmalonyl-CoA: 65.9
Methoxymalonyl-CoA: 65.7
Propionyl-CoA: 46.5
2-Methylbutyryl-CoA: 33.9
Ethylmalonyl-CoA: 32.6
CHC-CoA: 27.4
fatty_acid: 27.2
Benzoyl-CoA: 21.2
Isobutyryl-CoA: 20.6
Acetyl-CoA: 18.7
trans-1,2-CPDA: 9.3
3-Methylbutyryl-CoA: 0.0

TARA_SAMEA6039747_MAG_00000027-scaffold_428 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 8,963 nt. (total: 8,963 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8963:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_428_4

Search NORINE for peptide: strict or relaxed

AMP-binding (153..556): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQYvAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

AMP-binding (1208..1602): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6039747_MAG_00000027-scaffold_438 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 8,846 nt. (total: 8,846 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8846:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr) + (orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_438_4

Search NORINE for peptide: strict or relaxed

AMP-binding (515..972): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_438_5

Search NORINE for peptide: strict or relaxed

AMP-binding (17..432): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_465 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 8,564 nt. (total: 8,564 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8564:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-asn) + (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_465_1

Search NORINE for peptide: strict or relaxed

AMP-binding (1..216): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_465_2

Search NORINE for peptide: strict or relaxed

AMP-binding (471..882): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWgVGMViK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6039747_MAG_00000027-scaffold_483 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 8,292 nt. (total: 8,292 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6039747_MAG_00000027-scaffold_557 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 7,483 nt. (total: 7,483 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6039747_MAG_00000027-scaffold_575 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 7,394 nt. (total: 7,394 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7394:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_575_1

Search NORINE for peptide: strict or relaxed

AMP-binding (52..445): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_602 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 7,147 nt. (total: 7,147 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7147:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_602_3

Search NORINE for peptide: strict or relaxed

AMP-binding (253..657): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_636 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 6,834 nt. (total: 6,834 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6834:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_636_4

Search NORINE for peptide: strict or relaxed

AMP-binding (803..1209): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_659 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 6,637 nt. (total: 6,637 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6039747_MAG_00000027-scaffold_673 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 6,575 nt. (total: 6,575 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6575:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_673_1

Search NORINE for peptide: strict or relaxed

AMP-binding (174..581): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_676 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 6,571 nt. (total: 6,571 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for TARA_SAMEA6039747_MAG_00000027-scaffold_676_4 - Putative Class II

TARA_SAMEA6039747_MAG_00000027-scaffold_676_3 leader / core peptide: MKKKDVIRAWRDGEFFASLSEEERAELPAHPAALPAIDDEVLNSVTGG - CGDhbGLPCQLDhaDhaGFCDhbPCPPNYCDhaA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_676_3 - Class II: Cleavage pHMM score: -3.60; RODEO score: 0; Monoisotopic mass: 2315.0 Da; Molecular weight: 2316.7 Da; Number of bridges: 5

TARA_SAMEA6039747_MAG_00000027-scaffold_679 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 6,548 nt. (total: 6,548 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6548:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_679_2

PKS_AT (519..816): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 145.7
inactive: 94.7
Methoxymalonyl-CoA: 74.7
Methylmalonyl-CoA: 70.2
Propionyl-CoA: 54.2
Ethylmalonyl-CoA: 46.1
2-Methylbutyryl-CoA: 45.8
Isobutyryl-CoA: 41.1
CHC-CoA: 24.3
Benzoyl-CoA: 21.1
Acetyl-CoA: 20.5
trans-1,2-CPDA: 18.7
fatty_acid: 18.2
3-Methylbutyryl-CoA: 0.0

TARA_SAMEA6039747_MAG_00000027-scaffold_713 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 6,350 nt. (total: 6,350 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6350:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_713_1

Search NORINE for peptide: strict or relaxed

AMP-binding (467..878): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_726 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 6,293 nt. (total: 6,293 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6293:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 510 - 6246:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_726_3

Search NORINE for peptide: strict or relaxed

AMP-binding (658..965): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_809 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 5,791 nt. (total: 5,791 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5791:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_809_1

Search NORINE for peptide: strict or relaxed

AMP-binding (476..866): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6039747_MAG_00000027-scaffold_864 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 5,496 nt. (total: 5,496 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5496:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 115 - 5483:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6039747_MAG_00000027-scaffold_864_1

Search NORINE for peptide: strict or relaxed

AMP-binding (144..541): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_864_2

Search NORINE for peptide: strict or relaxed

AMP-binding (1..358): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6039747_MAG_00000027-scaffold_869 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 5,479 nt. (total: 5,479 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6039747_MAG_00000027-scaffold_886 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 5,375 nt. (total: 5,375 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_937 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 5,135 nt. (total: 5,135 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6039747_MAG_00000027-scaffold_968 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 5,009 nt. (total: 5,009 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it