TARA_SAMEA6034818_MAG_00000048 - 30 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

TARA_SAMEA6034818_MAG_00000048-scaffold_1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	lanthipeptide-class-ii	134,702	158,061
Region 1.2	NRPS	594,934	638,941

TARA_SAMEA6034818_MAG_00000048-scaffold_2

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	T1PKS	131,021	176,924
Region 2.2	T3PKS	196,564	237,631

TARA_SAMEA6034818_MAG_00000048-scaffold_3

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	hglE-KS	136,455	191,798

TARA_SAMEA6034818_MAG_00000048-scaffold_5

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	lassopeptide	1	19,902
Region 5.2	thioamitides	40,287	62,930

TARA_SAMEA6034818_MAG_00000048-scaffold_6

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	ladderane	34,651	75,868
Region 6.2	lanthipeptide-class-ii	225,337	248,603

TARA_SAMEA6034818_MAG_00000048-scaffold_7

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	ranthipeptide	57,731	81,049

TARA_SAMEA6034818_MAG_00000048-scaffold_9

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	NRPS	25,241	69,392

TARA_SAMEA6034818_MAG_00000048-scaffold_14

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	terpene	33,600	56,875

TARA_SAMEA6034818_MAG_00000048-scaffold_18

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	NRPS-like	135,321	177,378

TARA_SAMEA6034818_MAG_00000048-scaffold_20

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	LAP	39,416	62,380

TARA_SAMEA6034818_MAG_00000048-scaffold_21

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	NRPS-like	128,927	171,788

TARA_SAMEA6034818_MAG_00000048-scaffold_27

Region	Type	From	To	Most similar known cluster		Similarity
Region 27.1	thioamitides,RiPP-like	21,867	44,471

TARA_SAMEA6034818_MAG_00000048-scaffold_31

Region	Type	From	To	Most similar known cluster		Similarity
Region 31.1	proteusin,RiPP-like	27,782	60,449

TARA_SAMEA6034818_MAG_00000048-scaffold_33

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	lanthipeptide-class-i	577	26,092
Region 33.2	thiopeptide,LAP	62,546	97,485

TARA_SAMEA6034818_MAG_00000048-scaffold_35

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	lanthipeptide-class-i	72,818	97,366

TARA_SAMEA6034818_MAG_00000048-scaffold_39

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	RRE-containing	1,274	33,822

TARA_SAMEA6034818_MAG_00000048-scaffold_40

Region	Type	From	To	Most similar known cluster		Similarity
Region 40.1	thioamitides	3,500	26,099

TARA_SAMEA6034818_MAG_00000048-scaffold_44

Region	Type	From	To	Most similar known cluster		Similarity
Region 44.1	lanthipeptide-class-ii	15,279	38,503

TARA_SAMEA6034818_MAG_00000048-scaffold_46

Region	Type	From	To	Most similar known cluster		Similarity
Region 46.1	thioamitides	81,261	100,622

TARA_SAMEA6034818_MAG_00000048-scaffold_47

Region	Type	From	To	Most similar known cluster		Similarity
Region 47.1	butyrolactone	75,818	86,375

TARA_SAMEA6034818_MAG_00000048-scaffold_52

Region	Type	From	To	Most similar known cluster		Similarity
Region 52.1	NRPS-like	1	29,609

TARA_SAMEA6034818_MAG_00000048-scaffold_67

Region	Type	From	To	Most similar known cluster		Similarity
Region 67.1	ladderane	33,843	66,185

TARA_SAMEA6034818_MAG_00000048-scaffold_69

Region	Type	From	To	Most similar known cluster		Similarity
Region 69.1	LAP	10,029	35,626

TARA_SAMEA6034818_MAG_00000048-scaffold_76

Region	Type	From	To	Most similar known cluster		Similarity
Region 76.1	thioamitides	8,940	31,371

TARA_SAMEA6034818_MAG_00000048-scaffold_78

Region	Type	From	To	Most similar known cluster		Similarity
Region 78.1	lanthipeptide-class-iv	1,935	24,379

Region	Type	From	To	Similarity
Region 1.1	lanthipeptide-class-ii	134,702	158,061
Region 1.2	NRPS	594,934	638,941
Region 2.1	T1PKS	131,021	176,924
Region 2.2	T3PKS	196,564	237,631
Region 3.1	hglE-KS	136,455	191,798
Region 5.1	lassopeptide	1	19,902
Region 5.2	thioamitides	40,287	62,930
Region 6.1	ladderane	34,651	75,868
Region 6.2	lanthipeptide-class-ii	225,337	248,603
Region 7.1	ranthipeptide	57,731	81,049
Region 9.1	NRPS	25,241	69,392
Region 14.1	terpene	33,600	56,875
Region 18.1	NRPS-like	135,321	177,378
Region 20.1	LAP	39,416	62,380
Region 21.1	NRPS-like	128,927	171,788
Region 27.1	thioamitides,RiPP-like	21,867	44,471
Region 31.1	proteusin,RiPP-like	27,782	60,449
Region 33.1	lanthipeptide-class-i	577	26,092
Region 33.2	thiopeptide,LAP	62,546	97,485
Region 35.1	lanthipeptide-class-i	72,818	97,366
Region 39.1	RRE-containing	1,274	33,822
Region 40.1	thioamitides	3,500	26,099
Region 44.1	lanthipeptide-class-ii	15,279	38,503
Region 46.1	thioamitides	81,261	100,622
Region 47.1	butyrolactone	75,818	86,375
Region 52.1	NRPS-like	1	29,609
Region 67.1	ladderane	33,843	66,185
Region 69.1	LAP	10,029	35,626
Region 76.1	thioamitides	8,940	31,371
Region 78.1	lanthipeptide-class-iv	1,935	24,379

No secondary metabolite regions were found in these records:: TARA_SAMEA6034818_MAG_00000048-scaffold_4; TARA_SAMEA6034818_MAG_00000048-scaffold_8; TARA_SAMEA6034818_MAG_00000048-scaffold_10; TARA_SAMEA6034818_MAG_00000048-scaffold_11; TARA_SAMEA6034818_MAG_00000048-scaffold_12; TARA_SAMEA6034818_MAG_00000048-scaffold_13; TARA_SAMEA6034818_MAG_00000048-scaffold_15; TARA_SAMEA6034818_MAG_00000048-scaffold_16; TARA_SAMEA6034818_MAG_00000048-scaffold_17; TARA_SAMEA6034818_MAG_00000048-scaffold_19; TARA_SAMEA6034818_MAG_00000048-scaffold_22; TARA_SAMEA6034818_MAG_00000048-scaffold_23; TARA_SAMEA6034818_MAG_00000048-scaffold_24; TARA_SAMEA6034818_MAG_00000048-scaffold_25; TARA_SAMEA6034818_MAG_00000048-scaffold_26; TARA_SAMEA6034818_MAG_00000048-scaffold_28; TARA_SAMEA6034818_MAG_00000048-scaffold_29; TARA_SAMEA6034818_MAG_00000048-scaffold_30; TARA_SAMEA6034818_MAG_00000048-scaffold_32; TARA_SAMEA6034818_MAG_00000048-scaffold_34; TARA_SAMEA6034818_MAG_00000048-scaffold_36; TARA_SAMEA6034818_MAG_00000048-scaffold_37; TARA_SAMEA6034818_MAG_00000048-scaffold_38; TARA_SAMEA6034818_MAG_00000048-scaffold_41; TARA_SAMEA6034818_MAG_00000048-scaffold_42; TARA_SAMEA6034818_MAG_00000048-scaffold_43; TARA_SAMEA6034818_MAG_00000048-scaffold_45; TARA_SAMEA6034818_MAG_00000048-scaffold_48; TARA_SAMEA6034818_MAG_00000048-scaffold_49; TARA_SAMEA6034818_MAG_00000048-scaffold_50; TARA_SAMEA6034818_MAG_00000048-scaffold_51; TARA_SAMEA6034818_MAG_00000048-scaffold_53; TARA_SAMEA6034818_MAG_00000048-scaffold_54; TARA_SAMEA6034818_MAG_00000048-scaffold_55; TARA_SAMEA6034818_MAG_00000048-scaffold_56; TARA_SAMEA6034818_MAG_00000048-scaffold_57; TARA_SAMEA6034818_MAG_00000048-scaffold_58; TARA_SAMEA6034818_MAG_00000048-scaffold_59; TARA_SAMEA6034818_MAG_00000048-scaffold_60; TARA_SAMEA6034818_MAG_00000048-scaffold_61; TARA_SAMEA6034818_MAG_00000048-scaffold_62; TARA_SAMEA6034818_MAG_00000048-scaffold_63; TARA_SAMEA6034818_MAG_00000048-scaffold_64; TARA_SAMEA6034818_MAG_00000048-scaffold_65; TARA_SAMEA6034818_MAG_00000048-scaffold_66; TARA_SAMEA6034818_MAG_00000048-scaffold_68; TARA_SAMEA6034818_MAG_00000048-scaffold_70; TARA_SAMEA6034818_MAG_00000048-scaffold_71; TARA_SAMEA6034818_MAG_00000048-scaffold_72; TARA_SAMEA6034818_MAG_00000048-scaffold_73; TARA_SAMEA6034818_MAG_00000048-scaffold_74; TARA_SAMEA6034818_MAG_00000048-scaffold_75; TARA_SAMEA6034818_MAG_00000048-scaffold_77; TARA_SAMEA6034818_MAG_00000048-scaffold_79; TARA_SAMEA6034818_MAG_00000048-scaffold_80; TARA_SAMEA6034818_MAG_00000048-scaffold_81; TARA_SAMEA6034818_MAG_00000048-scaffold_82; TARA_SAMEA6034818_MAG_00000048-scaffold_83; TARA_SAMEA6034818_MAG_00000048-scaffold_84; TARA_SAMEA6034818_MAG_00000048-scaffold_85; TARA_SAMEA6034818_MAG_00000048-scaffold_86; TARA_SAMEA6034818_MAG_00000048-scaffold_87; TARA_SAMEA6034818_MAG_00000048-scaffold_88; TARA_SAMEA6034818_MAG_00000048-scaffold_89; TARA_SAMEA6034818_MAG_00000048-scaffold_90; TARA_SAMEA6034818_MAG_00000048-scaffold_91; TARA_SAMEA6034818_MAG_00000048-scaffold_92; TARA_SAMEA6034818_MAG_00000048-scaffold_93; TARA_SAMEA6034818_MAG_00000048-scaffold_94; TARA_SAMEA6034818_MAG_00000048-scaffold_95; TARA_SAMEA6034818_MAG_00000048-scaffold_96; TARA_SAMEA6034818_MAG_00000048-scaffold_97; TARA_SAMEA6034818_MAG_00000048-scaffold_98; TARA_SAMEA6034818_MAG_00000048-scaffold_99; TARA_SAMEA6034818_MAG_00000048-scaffold_100; TARA_SAMEA6034818_MAG_00000048-scaffold_101; TARA_SAMEA6034818_MAG_00000048-scaffold_102; TARA_SAMEA6034818_MAG_00000048-scaffold_103; TARA_SAMEA6034818_MAG_00000048-scaffold_104; TARA_SAMEA6034818_MAG_00000048-scaffold_105; TARA_SAMEA6034818_MAG_00000048-scaffold_106; TARA_SAMEA6034818_MAG_00000048-scaffold_107; TARA_SAMEA6034818_MAG_00000048-scaffold_108; TARA_SAMEA6034818_MAG_00000048-scaffold_109; TARA_SAMEA6034818_MAG_00000048-scaffold_110; TARA_SAMEA6034818_MAG_00000048-scaffold_111; TARA_SAMEA6034818_MAG_00000048-scaffold_112; TARA_SAMEA6034818_MAG_00000048-scaffold_113; TARA_SAMEA6034818_MAG_00000048-scaffold_114; TARA_SAMEA6034818_MAG_00000048-scaffold_115; TARA_SAMEA6034818_MAG_00000048-scaffold_116; TARA_SAMEA6034818_MAG_00000048-scaffold_117; TARA_SAMEA6034818_MAG_00000048-scaffold_118

Compact view

TARA_SAMEA6034818_MAG_00000048-scaffold_1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 134,702 - 158,061 nt. (total: 23,360 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000048-scaffold_1_116 - Putative Class II

TARA_SAMEA6034818_MAG_00000048-scaffold_1_108 leader / core peptide: MGQNCGRFAETLISG - YLDGVLDLDhaDRRGVELHLRRCDhbICRYLLADLRRIRDhbDhbMMDhbDhaCQQDFPIELLVRDhaL
TARA_SAMEA6034818_MAG_00000048-scaffold_1_114 leader / core peptide: MKKHDIIRAWRDGEFAAQLSDAQRGVLPANPAEMPAIDDDVLKSITGG - CDhaFWGACPDhbDhaAICDhaPCPPLQCH
TARA_SAMEA6034818_MAG_00000048-scaffold_1_115 leader / core peptide: MKKNDIIRAWRDGDFAAQLSDAQRGALPANPAEMPAIDDDVLKTITGG - CDhaFWGACPDhbDhaDhaICDhbPCPPNYCH

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_1_108 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 6395.4 Da

Molecular weight: 6399.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 6417.5 Da N = 1; 6435.5 Da N = 2; 6453.6 Da N = 3; 6471.6 Da N = 4

TARA_SAMEA6034818_MAG_00000048-scaffold_1_114 - Class II

Cleavage pHMM score: -3.10

RODEO score: 0

Monoisotopic mass: 2234.9 Da

Molecular weight: 2236.6 Da

Number of bridges: 4

TARA_SAMEA6034818_MAG_00000048-scaffold_1_115 - Class II

Cleavage pHMM score: -2.50

RODEO score: 0

Monoisotopic mass: 2282.9 Da

Molecular weight: 2284.6 Da

Number of bridges: 5

TARA_SAMEA6034818_MAG_00000048-scaffold_1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 594,934 - 638,941 nt. (total: 44,008 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 594933 - 638941:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_1_487

Search NORINE for peptide: strict or relaxed

AMP-binding (491..886): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSaLiAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000048-scaffold_1_498

CAL_domain (44..469): pk

minowa: NH2

Prediction, score:

NH2: 54.8
fatty_acid: 34.1
AHBA: 21.2
shikimic_acid: 12.8
Acetyl-CoA: -2.8

TARA_SAMEA6034818_MAG_00000048-scaffold_2 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 131,021 - 176,924 nt. (total: 45,904 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6034818_MAG_00000048-scaffold_2 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 196,564 - 237,631 nt. (total: 41,068 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6034818_MAG_00000048-scaffold_3 - Region 1 - hglE-KS

Download region GenBank file

Download region SVG

Location: 136,455 - 191,798 nt. (total: 55,344 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 136454 - 191798:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_3_123

PKS_AT (900..1193): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 26.8
Propionyl-CoA: 13.8
Methylmalonyl-CoA: 10.6
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TARA_SAMEA6034818_MAG_00000048-scaffold_3_124

PKS_AT (586..879): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.9
Methoxymalonyl-CoA: 50.1
Methylmalonyl-CoA: 39.2
Propionyl-CoA: 37.0
inactive: 29.5
Isobutyryl-CoA: 16.1
fatty_acid: 14.4
2-Methylbutyryl-CoA: 12.1
CHC-CoA: 11.7
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TARA_SAMEA6034818_MAG_00000048-scaffold_5 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 19,902 nt. (total: 19,902 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptide(s) for TARA_SAMEA6034818_MAG_00000048-scaffold_5_8 - Putative Class I

TARA_SAMEA6034818_MAG_00000048-scaffold_5_8 leader / core peptide / cleaved tail: MKTYETPEIFELGDAITETR - SCSCKCSDGCCGKKS - GGEDE

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Lasso peptides

Core peptide predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_5_8 - Class I: Cleavage pHMM score: 6.00; RODEO score: 18; Monoisotopic mass: 1480.5 Da; Molecular weight: 1481.7 Da; Number of bridges: 2

TARA_SAMEA6034818_MAG_00000048-scaffold_5 - Region 2 - thioamitides

Download region GenBank file

Download region SVG

Location: 40,287 - 62,930 nt. (total: 22,644 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_6 - Region 1 - ladderane

Download region GenBank file

Download region SVG

Location: 34,651 - 75,868 nt. (total: 41,218 nt) Show pHMM detection rules used

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_6 - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 225,337 - 248,603 nt. (total: 23,267 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000048-scaffold_6_174 - Putative Class II

TARA_SAMEA6034818_MAG_00000048-scaffold_6_169 leader / core peptide: MREDAERLGA - RAYHDhaEPDhaAFGRAVDhaRKDGERNDhaDhaVMERPDhbDhaGQGLFPRCRGLRRRDhaCGHFFFDhaAQLRLDQVVVEAFPGD
TARA_SAMEA6034818_MAG_00000048-scaffold_6_173 leader / core peptide: MKKQQVIRAWKDEEYLQSLSAKERALIPASPAGIVDLQDSDLQSISGG - CDhaGICDhbYGGWPDhbCFCC
TARA_SAMEA6034818_MAG_00000048-scaffold_6_179 leader / core peptide: MTTLLALQLLLLTTTPPVTVEPIVVGPQSAGETLCFCVCAAPTHELQDVTTS - GDhaCDhaALVGQDhbCYGKDhaGIGDhbFDhbFCIPG

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000048-scaffold_6_176 - Putative Class II

TARA_SAMEA6034818_MAG_00000048-scaffold_6_173 leader / core peptide: MKKQQVIRAWKDEEYLQSLSAKERALIPASPAGIVDLQDSDLQSISGG - CDhaGICDhbYGGWPDhbCFCC
TARA_SAMEA6034818_MAG_00000048-scaffold_6_179 leader / core peptide: MTTLLALQLLLLTTTPPVTVEPIVVGPQSAGETLCFCVCAAPTHELQDVTTS - GDhaCDhaALVGQDhbCYGKDhaGIGDhbFDhbFCIPG

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_6_173 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 1645.6 Da

Molecular weight: 1646.9 Da

Number of bridges: 3

TARA_SAMEA6034818_MAG_00000048-scaffold_6_179 - Class II

Cleavage pHMM score: -5.60

RODEO score: 0

Monoisotopic mass: 2445.2 Da

Molecular weight: 2446.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2464.8 Da N = 1; 2482.8 Da N = 2; 2500.9 Da N = 3

TARA_SAMEA6034818_MAG_00000048-scaffold_6_169 - Class II

Cleavage pHMM score: -1.10

RODEO score: 0

Monoisotopic mass: 7604.9 Da

Molecular weight: 7609.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 7627.5 Da N = 1; 7645.5 Da N = 2; 7663.5 Da N = 3; 7681.5 Da N = 4; 7699.6 Da N = 5; 7717.6 Da N = 6; 7735.6 Da N = 7

TARA_SAMEA6034818_MAG_00000048-scaffold_6_173 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 1645.6 Da

Molecular weight: 1646.9 Da

Number of bridges: 3

TARA_SAMEA6034818_MAG_00000048-scaffold_6_179 - Class II

Cleavage pHMM score: -5.60

RODEO score: 0

Monoisotopic mass: 2445.2 Da

Molecular weight: 2446.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2464.8 Da N = 1; 2482.8 Da N = 2; 2500.9 Da N = 3

TARA_SAMEA6034818_MAG_00000048-scaffold_7 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 57,731 - 81,049 nt. (total: 23,319 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_9 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 25,241 - 69,392 nt. (total: 44,152 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 25240 - 69392:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_9_28

Search NORINE for peptide: strict or relaxed

AMP-binding (9..427): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmFYLGsqCK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6034818_MAG_00000048-scaffold_9_30

Search NORINE for peptide: strict or relaxed

AMP-binding (458..852): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6034818_MAG_00000048-scaffold_14 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 33,600 - 56,875 nt. (total: 23,276 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_18 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 135,321 - 177,378 nt. (total: 42,058 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 135320 - 177378:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_18_116

Search NORINE for peptide: strict or relaxed

AMP-binding (45..480): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: eqvvaGGPvK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 40% (weak)

TARA_SAMEA6034818_MAG_00000048-scaffold_20 - Region 1 - LAP

Download region GenBank file

Download region SVG

Location: 39,416 - 62,380 nt. (total: 22,965 nt) Show pHMM detection rules used

LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_21 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 128,927 - 171,788 nt. (total: 42,862 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6034818_MAG_00000048-scaffold_27 - Region 1 - RiPP-like,thioamitides

Download region GenBank file

Download region SVG

Location: 21,867 - 44,471 nt. (total: 22,605 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03882) and TfuA)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_31 - Region 1 - RiPP-like,proteusin

Download region GenBank file

Download region SVG

Location: 27,782 - 60,449 nt. (total: 32,668 nt) Show pHMM detection rules used

proteusin: (PoyD or TIGR03793)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_33 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 577 - 26,092 nt. (total: 25,516 nt) Show pHMM detection rules used

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000048-scaffold_33_2 - Putative Class I

TARA_SAMEA6034818_MAG_00000048-scaffold_33_7 leader / core peptide: MKKKLRRLRLERETVRNLTPE - NLEGVAGGGWDhbDYDhbCHNDhaCDPDhaIDhbRPQDhaICNDhaCIQWPDhbVCC

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000048-scaffold_33_9 - Putative Class I

TARA_SAMEA6034818_MAG_00000048-scaffold_33_7 leader / core peptide: MKKKLRRLRLERETVRNLTPE - NLEGVAGGGWDhbDYDhbCHNDhaCDPDhaIDhbRPQDhaICNDhaCIQWPDhbVCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_33_7 - Class I

Cleavage pHMM score: -13.90

RODEO score: 21

Monoisotopic mass: 4270.9 Da

Molecular weight: 4273.7 Da

Number of bridges: 6

Alternative weights: (assuming N unmodified Ser/Thr residues); 4291.8 Da N = 1; 4309.8 Da N = 2

TARA_SAMEA6034818_MAG_00000048-scaffold_33_7 - Class I

Cleavage pHMM score: -13.90

RODEO score: 21

Monoisotopic mass: 4270.9 Da

Molecular weight: 4273.7 Da

Number of bridges: 6

Alternative weights: (assuming N unmodified Ser/Thr residues); 4291.8 Da N = 1; 4309.8 Da N = 2

TARA_SAMEA6034818_MAG_00000048-scaffold_33 - Region 2 - LAP,thiopeptide

Download region GenBank file

Download region SVG

Location: 62,546 - 97,485 nt. (total: 34,940 nt) Show pHMM detection rules used

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)
LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Thiopeptides

Thiopeptide predictions

No core peptides found.

Thiopeptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6034818_MAG_00000048-scaffold_35 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 72,818 - 97,366 nt. (total: 24,549 nt) Show pHMM detection rules used

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

TARA_SAMEA6034818_MAG_00000048-scaffold_39 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1,274 - 33,822 nt. (total: 32,549 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_40 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 3,500 - 26,099 nt. (total: 22,600 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_44 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 15,279 - 38,503 nt. (total: 23,225 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for TARA_SAMEA6034818_MAG_00000048-scaffold_44_19 - Putative Class II

TARA_SAMEA6034818_MAG_00000048-scaffold_44_18 leader / core peptide: MKQQQIVEAWTNADYFFSLSDEERQKLPDNPVGMVELSQETLRDVLGA - DhaHDhaDhbCWMDhaCHRDhbVDPCCDhaDDhbCYDhbADhaCCCCC
allorf_023785_023922 leader / core peptide: LTFIPISLKFLRRRVDFELAVGFAA - CLDLALDLHADhbLLRDhaCLDhbPR
allorf_023792_024025 leader / core peptide: MRDGGLPRQHMKRDMQAA - FRDNARLNRNDhaCDhaCRDhbDhaILADhaNNFVGEDhaHEDQEPDPDhaRQRNRQRARNRPDhaDhaVGDhbDhaRRDhaE
allorf_024560_024706 leader / core peptide: LILPTQSSISLGA - LLLRGFDhbPDhaDhaACLEGDhbDhaNRGERDhbRDhbCRYNHVPWRF

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

TARA_SAMEA6034818_MAG_00000048-scaffold_44_18 - Class II

Cleavage pHMM score: 0.40

RODEO score: 0

Monoisotopic mass: 3133.1 Da

Molecular weight: 3135.6 Da

Number of bridges: 9

allorf_023785_023922 - Class II

Cleavage pHMM score: -3.90

RODEO score: 0

Monoisotopic mass: 2169.2 Da

Molecular weight: 2170.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2188.6 Da N = 1

allorf_023792_024025 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 6584.3 Da

Molecular weight: 6588.0 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 6606.0 Da N = 1; 6624.0 Da N = 2; 6642.1 Da N = 3; 6660.1 Da N = 4; 6678.1 Da N = 5; 6696.1 Da N = 6; 6714.1 Da N = 7; 6732.2 Da N = 8; 6750.2 Da N = 9; 6768.2 Da N = 10

allorf_024560_024706 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 3954.0 Da

Molecular weight: 3956.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3974.5 Da N = 1; 3992.5 Da N = 2; 4010.5 Da N = 3; 4028.5 Da N = 4; 4046.5 Da N = 5

TARA_SAMEA6034818_MAG_00000048-scaffold_46 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 81,261 - 100,622 nt. (total: 19,362 nt) Show pHMM detection rules used

Region on contig edge.

thioamitides: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_47 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 75,818 - 86,375 nt. (total: 10,558 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_52 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 29,609 nt. (total: 29,609 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

TARA_SAMEA6034818_MAG_00000048-scaffold_67 - Region 1 - ladderane

Download region GenBank file

Download region SVG

Location: 33,843 - 66,185 nt. (total: 32,343 nt) Show pHMM detection rules used

Region on contig edge.

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_69 - Region 1 - LAP

Download region GenBank file

Download region SVG

Location: 10,029 - 35,626 nt. (total: 25,598 nt) Show pHMM detection rules used

LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_76 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 8,940 - 31,371 nt. (total: 22,432 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6034818_MAG_00000048-scaffold_78 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 1,935 - 24,379 nt. (total: 22,445 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.