TARA_SAMEA6025823_MAG_00000013 - 15 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

TARA_SAMEA6025823_MAG_00000013-scaffold_2

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	transAT-PKS,PKS-like	1	35,012

TARA_SAMEA6025823_MAG_00000013-scaffold_5

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS	158,204	219,941

TARA_SAMEA6025823_MAG_00000013-scaffold_7

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	NRPS	70,566	133,726

TARA_SAMEA6025823_MAG_00000013-scaffold_9

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	lassopeptide	19,410	41,975

TARA_SAMEA6025823_MAG_00000013-scaffold_10

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	betalactone	83,944	112,093
Region 10.2	RiPP-like	124,969	135,883

TARA_SAMEA6025823_MAG_00000013-scaffold_12

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	betalactone	112,458	144,414

TARA_SAMEA6025823_MAG_00000013-scaffold_13

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	phosphonate	73,770	114,594

TARA_SAMEA6025823_MAG_00000013-scaffold_14

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	NRPS,T1PKS	1	44,140

TARA_SAMEA6025823_MAG_00000013-scaffold_16

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	NRPS	37,434	92,631

TARA_SAMEA6025823_MAG_00000013-scaffold_17

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	NRPS	60,781	119,442

TARA_SAMEA6025823_MAG_00000013-scaffold_20

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	hserlactone	47,060	67,812

TARA_SAMEA6025823_MAG_00000013-scaffold_29

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	RRE-containing	34,947	55,216

TARA_SAMEA6025823_MAG_00000013-scaffold_30

Region	Type	From	To	Most similar known cluster		Similarity
Region 30.1	redox-cofactor	15,955	38,122

TARA_SAMEA6025823_MAG_00000013-scaffold_31

Region	Type	From	To	Most similar known cluster		Similarity
Region 31.1	NRPS	1	44,985

Region	Type	From	To	Similarity
Region 2.1	transAT-PKS,PKS-like	1	35,012
Region 5.1	NRPS	158,204	219,941
Region 7.1	NRPS	70,566	133,726
Region 9.1	lassopeptide	19,410	41,975
Region 10.1	betalactone	83,944	112,093
Region 10.2	RiPP-like	124,969	135,883
Region 12.1	betalactone	112,458	144,414
Region 13.1	phosphonate	73,770	114,594
Region 14.1	NRPS,T1PKS	1	44,140
Region 16.1	NRPS	37,434	92,631
Region 17.1	NRPS	60,781	119,442
Region 20.1	hserlactone	47,060	67,812
Region 29.1	RRE-containing	34,947	55,216
Region 30.1	redox-cofactor	15,955	38,122
Region 31.1	NRPS	1	44,985

No secondary metabolite regions were found in these records:: TARA_SAMEA6025823_MAG_00000013-scaffold_1; TARA_SAMEA6025823_MAG_00000013-scaffold_3; TARA_SAMEA6025823_MAG_00000013-scaffold_4; TARA_SAMEA6025823_MAG_00000013-scaffold_6; TARA_SAMEA6025823_MAG_00000013-scaffold_8; TARA_SAMEA6025823_MAG_00000013-scaffold_11; TARA_SAMEA6025823_MAG_00000013-scaffold_15; TARA_SAMEA6025823_MAG_00000013-scaffold_18; TARA_SAMEA6025823_MAG_00000013-scaffold_19; TARA_SAMEA6025823_MAG_00000013-scaffold_21; TARA_SAMEA6025823_MAG_00000013-scaffold_22; TARA_SAMEA6025823_MAG_00000013-scaffold_23; TARA_SAMEA6025823_MAG_00000013-scaffold_24; TARA_SAMEA6025823_MAG_00000013-scaffold_25; TARA_SAMEA6025823_MAG_00000013-scaffold_26; TARA_SAMEA6025823_MAG_00000013-scaffold_27; TARA_SAMEA6025823_MAG_00000013-scaffold_28; TARA_SAMEA6025823_MAG_00000013-scaffold_32; TARA_SAMEA6025823_MAG_00000013-scaffold_33; TARA_SAMEA6025823_MAG_00000013-scaffold_34; TARA_SAMEA6025823_MAG_00000013-scaffold_35; TARA_SAMEA6025823_MAG_00000013-scaffold_36; TARA_SAMEA6025823_MAG_00000013-scaffold_37; TARA_SAMEA6025823_MAG_00000013-scaffold_38; TARA_SAMEA6025823_MAG_00000013-scaffold_39; TARA_SAMEA6025823_MAG_00000013-scaffold_40; TARA_SAMEA6025823_MAG_00000013-scaffold_41; TARA_SAMEA6025823_MAG_00000013-scaffold_42; TARA_SAMEA6025823_MAG_00000013-scaffold_43; TARA_SAMEA6025823_MAG_00000013-scaffold_44; TARA_SAMEA6025823_MAG_00000013-scaffold_45; TARA_SAMEA6025823_MAG_00000013-scaffold_46; TARA_SAMEA6025823_MAG_00000013-scaffold_47; TARA_SAMEA6025823_MAG_00000013-scaffold_48; TARA_SAMEA6025823_MAG_00000013-scaffold_49; TARA_SAMEA6025823_MAG_00000013-scaffold_50; TARA_SAMEA6025823_MAG_00000013-scaffold_51; TARA_SAMEA6025823_MAG_00000013-scaffold_52; TARA_SAMEA6025823_MAG_00000013-scaffold_53; TARA_SAMEA6025823_MAG_00000013-scaffold_54; TARA_SAMEA6025823_MAG_00000013-scaffold_55; TARA_SAMEA6025823_MAG_00000013-scaffold_56; TARA_SAMEA6025823_MAG_00000013-scaffold_57; TARA_SAMEA6025823_MAG_00000013-scaffold_58; TARA_SAMEA6025823_MAG_00000013-scaffold_59; TARA_SAMEA6025823_MAG_00000013-scaffold_60; TARA_SAMEA6025823_MAG_00000013-scaffold_61; TARA_SAMEA6025823_MAG_00000013-scaffold_62; TARA_SAMEA6025823_MAG_00000013-scaffold_63; TARA_SAMEA6025823_MAG_00000013-scaffold_64; TARA_SAMEA6025823_MAG_00000013-scaffold_65; TARA_SAMEA6025823_MAG_00000013-scaffold_66; TARA_SAMEA6025823_MAG_00000013-scaffold_67; TARA_SAMEA6025823_MAG_00000013-scaffold_68; TARA_SAMEA6025823_MAG_00000013-scaffold_69; TARA_SAMEA6025823_MAG_00000013-scaffold_70; TARA_SAMEA6025823_MAG_00000013-scaffold_71; TARA_SAMEA6025823_MAG_00000013-scaffold_72; TARA_SAMEA6025823_MAG_00000013-scaffold_73

Compact view

TARA_SAMEA6025823_MAG_00000013-scaffold_2 - Region 1 - PKS-like,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 35,012 nt. (total: 35,012 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 35012:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal)
Non-colinear ordering:: TARA_SAMEA6025823_MAG_00000013-scaffold_2_6 + TARA_SAMEA6025823_MAG_00000013-scaffold_2_5 + TARA_SAMEA6025823_MAG_00000013-scaffold_2_7 + TARA_SAMEA6025823_MAG_00000013-scaffold_2_1

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6025823_MAG_00000013-scaffold_2_6

PKS_AT (4..296): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.7
Methoxymalonyl-CoA: 27.7
inactive: 26.8
Methylmalonyl-CoA: 16.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TARA_SAMEA6025823_MAG_00000013-scaffold_2_7

PKS_AT (7..299): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 36.8
inactive: 29.8
Methoxymalonyl-CoA: 18.2
Methylmalonyl-CoA: 11.8
Propionyl-CoA: 10.8
Benzoyl-CoA: 9.0
Isobutyryl-CoA: 8.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TARA_SAMEA6025823_MAG_00000013-scaffold_5 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 158,204 - 219,941 nt. (total: 61,738 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 158203 - 219941:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - leu - D-val - X - ile - gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6025823_MAG_00000013-scaffold_5_154

Search NORINE for peptide: strict or relaxed

AMP-binding (458..859): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1530..1924): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2590..2989): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWLGmTFK
Nearest Stachelhaus code:: val, ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (4126..4535): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

AMP-binding (5201..5600): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGmTyK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (6262..6659): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6025823_MAG_00000013-scaffold_7 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 70,566 - 133,726 nt. (total: 63,161 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 70565 - 133726:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-thr) + (pro - pro - leu - thr) + (D-val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6025823_MAG_00000013-scaffold_7_69

Search NORINE for peptide: strict or relaxed

AMP-binding (528..929): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

TARA_SAMEA6025823_MAG_00000013-scaffold_7_70

Search NORINE for peptide: strict or relaxed

AMP-binding (476..896): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVaK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

AMP-binding (1558..1978): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVaK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

AMP-binding (2638..3033): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (3692..4101): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6025823_MAG_00000013-scaffold_7_71

Search NORINE for peptide: strict or relaxed

AMP-binding (492..901): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6025823_MAG_00000013-scaffold_9 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 19,410 - 41,975 nt. (total: 22,566 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptide(s) for TARA_SAMEA6025823_MAG_00000013-scaffold_9_22 - Putative Class II

TARA_SAMEA6025823_MAG_00000013-scaffold_9_22 leader / core peptide / cleaved tail: MNELIELGVLNTELKSQNNGALPDHELRDLGLVVAETK - AHDHGTKMDDTFPSTSPDSLSR

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Lasso peptides

Core peptide predictions

TARA_SAMEA6025823_MAG_00000013-scaffold_9_22 - Class II: Cleavage pHMM score: 3.60; RODEO score: 23; Monoisotopic mass: 2383.0 Da; Molecular weight: 2384.5 Da; Number of bridges: 0

TARA_SAMEA6025823_MAG_00000013-scaffold_10 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 83,944 - 112,093 nt. (total: 28,150 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6025823_MAG_00000013-scaffold_10 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 124,969 - 135,883 nt. (total: 10,915 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6025823_MAG_00000013-scaffold_12 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 112,458 - 144,414 nt. (total: 31,957 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6025823_MAG_00000013-scaffold_13 - Region 1 - phosphonate

Download region GenBank file

Download region SVG

Location: 73,770 - 114,594 nt. (total: 40,825 nt) Show pHMM detection rules used

phosphonate: phosphonates

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6025823_MAG_00000013-scaffold_14 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 44,140 nt. (total: 44,140 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 44140:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 25533:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6025823_MAG_00000013-scaffold_14_1

PKS_AT (605..818): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 31.5
Malonyl-CoA: 26.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TARA_SAMEA6025823_MAG_00000013-scaffold_14_13

Search NORINE for peptide: strict or relaxed

CAL_domain (47..488): pk

minowa: NH2

Prediction, score:

NH2: 186.7
fatty_acid: 31.0
AHBA: 8.1
Acetyl-CoA: 2.9
shikimic_acid: 0.0

AMP-binding (1159..1559): ser

NRPSPredictor2: ser

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DiWHISLIeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

TARA_SAMEA6025823_MAG_00000013-scaffold_16 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 37,434 - 92,631 nt. (total: 55,198 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 37433 - 92631:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro - X - pro - gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6025823_MAG_00000013-scaffold_16_47

Search NORINE for peptide: strict or relaxed

AMP-binding (493..916): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVcK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

AMP-binding (1582..1990): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

AMP-binding (2652..3075): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVcK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

AMP-binding (3742..4134): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6025823_MAG_00000013-scaffold_17 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 60,781 - 119,442 nt. (total: 58,662 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 60780 - 119442:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - leu - pro - D-phe - D-X - gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6025823_MAG_00000013-scaffold_17_68

Search NORINE for peptide: strict or relaxed

AMP-binding (20..430): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vAvgAGmglK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 40% (weak)

TARA_SAMEA6025823_MAG_00000013-scaffold_17_76

Search NORINE for peptide: strict or relaxed

AMP-binding (291..694): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: rlQFInqLcK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 50% (weak)

TARA_SAMEA6025823_MAG_00000013-scaffold_17_79

Search NORINE for peptide: strict or relaxed

AMP-binding (497..899): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1564..1959): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2620..3043): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAqVcK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (3712..4110): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTvAGVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 90% (moderate)

AMP-binding (5254..5654): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCtFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (6801..7202): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

TARA_SAMEA6025823_MAG_00000013-scaffold_20 - Region 1 - hserlactone

Download region GenBank file

Download region SVG

Location: 47,060 - 67,812 nt. (total: 20,753 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6025823_MAG_00000013-scaffold_29 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 34,947 - 55,216 nt. (total: 20,270 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6025823_MAG_00000013-scaffold_30 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 15,955 - 38,122 nt. (total: 22,168 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

TARA_SAMEA6025823_MAG_00000013-scaffold_31 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 44,985 nt. (total: 44,985 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 44985:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asp - ser - D-X - thr - X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

TARA_SAMEA6025823_MAG_00000013-scaffold_31_1

Search NORINE for peptide: strict or relaxed

AMP-binding (462..852): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DiTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

AMP-binding (1549..1946): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2653..3048): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (4151..4553): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5231..5629): X

NRPSPredictor2: glu, gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvWSaGlIHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 70% (weak)

TARA_SAMEA6025823_MAG_00000013-scaffold_31_2

Search NORINE for peptide: strict or relaxed

AMP-binding (507..901): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (1581..1979): X

NRPSPredictor2: glu, gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWnLgLIhK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)